KEGG   Bacillus anthracis Ames: BA_1253Help
Entry
BA_1253           CDS       T00129                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ban  Bacillus anthracis Ames
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BA_1253 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BA_1253 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BA_1253 (trpB)
Enzymes [BR:ban01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BA_1253 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1207447..1208640
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEAFQKELNHYLKTYVGRET
PLYFAENMTEYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKEDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcgatggaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaaca
ccgctttatttcgctgagaatatgacggagtattgcggaggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaacaatacaattggtcaggcactt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggggctggacaacacggt
gttgcaacagctacggtatgtgcccttctcggtttagagtgcgtcatctttatgggagaa
gaagatgtgagacgtcaaaaattaaatgtgtttcgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacacgtgcatgatacgcactacattatgggatctgttctcggaccgcatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattgggaatgagacgaaaaaacaatat
gaagcgttagaaggaaagttaccagaagcagtcgttgcttgcattggtggtgggagtaac
gcaatgggaatgttttatccgtttgtacatgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggcgttttacacggatcgatgatgtatcttctgcaaaatgaagaaggacaaattcaagaa
gcgcactctatttcagcaggacttgattacccaggtgttggtccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaggcgttagaagcgttt
cagttattaacgaaaaaagaagggattatcccggcgttagaaagctcgcatgctgtcgca
tacgcattaaaattagcgccgcaaatgaaggaagatgaaggacttgtcatttgtttatcc
ggccgtggtgataaagatgtagagagtataaaacgttacatggaagaggtgtaa

DBGET integrated database retrieval system