KEGG   Bacillus anthracis Ames: BA_1532Help
Entry
BA_1532           CDS       T00129                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ban  Bacillus anthracis Ames
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ban00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1447500..1448069
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcaatt
ggagatgaccctaatcgagagggagtacttgatacaccaaagcgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagaacatttacacaaagtgttcgga
gaagatcatgaggagcttgtactagtaaaagatataccgttttattcgatgtgtgagcat
catttagttccattctatggagttgctcacgttgcatatattccgcaaggcggaaaagtg
acagggttaagtaaattagctcgtactgtagatacaattgcacgtcgtccacaactgcaa
gaacgtattacatcaacagtagcgaactctattatggaagtactagagccgcatggtgta
atggtagtagtagaagcggaacatatgtgtatgacgatgcgcggtgtgaaaaagccaggt
gcaaaaacagtaacaacagcagtgcgtggtgtgctagaaaatgatgctgcagcacgtagt
gaaattttatcttttattaaaacgaagtaa

DBGET integrated database retrieval system