KEGG   Bacillus anthracis Ames: BA_1969Help
Entry
BA_1969           CDS       T00129                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ban  Bacillus anthracis Ames
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BA_1969 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BA_1969 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BA_1969 (thrC)
Enzymes [BR:ban01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BA_1969 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1851927..1852985
Genome map
AA seq 352 aa AA seqDB search
MYKGLLNQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAEEEPITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagggctattaaaccaatatgcttcttatttaccggtaaatgaaaacacacca
gatgtgagcttaatggaaggaaatacaccccttattccgttattaaacatatcaaaacaa
ttagggattcagttatacgggaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggcatggtaatggctgttgcgaaggcgaaagaagaaggttcggaggcaatcatttgt
gcatcgacaggtaatacatcagcatcggctgccgcatacgcggcacgccttggaatgaaa
tgtattatcgtaataccggaaggaaagattgcacatggaaaattagcacaagcagttgcg
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcattaaaggctgtaaga
aatatcgctgaggaagagccgattacgttagtaaactcagtgaatccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgatcagttgcaacgtgcaccagatgtttta
gcgattcctgttgggaatgccggaaatattacagcgtactggaaaggtttctgtgaatat
gagaaagaaaaaggttataaaaagccaagaattcatgggtttgaagcggaaggagcagct
gcaattgtaaaagggcatgtaattgacgagccagaaacaattgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcggtagaggctgctgagcaatctcacggcgaaata
gatatggtatcagatgaagagattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagccggtgtaatgaaacatgttcaatct
ggaaaaatcaaaaagggagaaacagttgttgcagttttaactggaaatggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system