KEGG   Bacillus anthracis Ames: BA_2237Help
Entry
BA_2237           CDS       T00129                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ban  Bacillus anthracis Ames
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ban00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ban00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Structure
PDB: 

Jmol
Position
2088843..2089331
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttcatttatggtcgcaatggacgaaaatagagtaattggtaaagataataat
ttaccttggcgtttaccgagtgaattgcagtatgtaaagaaaacaacgatgggtcacccg
cttattatgggaagaaaaaactatgaagcgattggtagaccactgcctggaagacgtaat
attattgtaactcgcaatgaaggatatcatgttgaaggctgtgaagtagcacattctgta
gaagaagtgtttgagctatgcaaaaatgaagaagagatctttatttttggcggagcacaa
atttatgatctctttttaccttacgtagacaagttatatataacaaaaatccatcatgca
tttgaaggagatacatttttcccagaaatggatatgacaaattggaaagaagtttttgtt
gaaaaaggtttaacggatgaaaaaaatccgtatacgtattattaccatgtatatgagaaa
caacaataa

DBGET integrated database retrieval system