KEGG   Bacillus anthracis Ames: BA_2418Help
Entry
BA_2418           CDS       T00129                                 

Gene name
hemY-2
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ban  Bacillus anthracis Ames
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BA_2418 (hemY-2)
Enzymes [BR:ban01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BA_2418 (hemY-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2253813..2255213
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKFKKDNNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLVKDLNLEGEMVYNETGISYIYSDNTLHPIPSDTIFGIPMSVESLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLSLFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEMLTETV
VKKGAVTTAVSKQGDRYEISFANHDSIHADYVVLAAPHDIAETLLQSNELNEQFHTFKNS
SLVSIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKNYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQALQTL
QEKMMNLYPNIYLAGASYYGVGIGACIGNGKNIANEIIATLNEPSN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggttgttgttatcggtggaggtataacgggactttctactatgttttattta
gaaaaattcaaaaaggataataatatcgatttaaatttaatccttgtagaaaaagaagag
tacttaggtggtaaaatccatagtgtagaagaaaaggattttattatggaatcaggagcg
gattctattgttgcacgtaatgaacatgttatgccacttgtaaaagatttaaatttagaa
ggagaaatggtatataacgagacgggtatttcttacatatattctgataatactttacat
ccaattccgtctgacactatatttgggataccgatgagtgtcgagtcgttgtttagcagt
acgctagtatcaacgaaggggaaaattgttgctttaaaagattttataacgaaaaataaa
gagtttacaaaagatacatccctttccctatttttagaaagctttttagggaaagaatta
gtagaaagacaaattgcgccagtgctttcaggtgtatattctggtaaattgaacgagctt
acaatggcatctacattaccatatttactggactataaaaataaatatggaagtattatt
aaaggttttgaagagaataaaaaacagtttcaatcagcaggaaacaaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaaatgctgactgagacggtt
gttaagaaaggtgctgtaacgacagctgtaagcaaacaaggtgatcgctatgaaatctct
tttgcaaatcacgattcaatccacgctgattatgttgttttagcagctccgcatgatatc
gcagaaactttattacagtctaatgagttaaacgaacagtttcatacatttaaaaactca
tctcttgtaagtatttacttaggatttgacatactagatgaacaattaccggcggacggt
acaggatttatcgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagc
cggaagtggaaacatacatctggaaaacaaaaactattagtgagaatgttttataagagt
actaatccagtatatgaaacgattaaaaattatagtgaagaagaattagtacgggttgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagtgaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcgcttcaaacatta
caagaaaaaatgatgaatctttaccctaatatatacttagctggcgcttcctattatggt
gttggtattggtgcgtgtattggaaatggaaagaacattgcaaatgaaatcattgcaaca
ttaaatgaaccatcaaattaa

DBGET integrated database retrieval system