KEGG   Bacillus anthracis Ames: BA_3236Help
Entry
BA_3236           CDS       T00129                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ban  Bacillus anthracis Ames
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BA_3236
Enzymes [BR:ban01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     BA_3236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(2980200..2981195)
Genome map
AA seq 331 aa AA seqDB search
MNLAKFPRKKYTESYTPIEKLNNFSEALGGPTIYFKRDDLLGLTAGGNKTRKLEFLVADA
QAKGADTLITAGGIQSNHCRLTLAAAVKEKMKCILVLEEGLEPEEKPDFNGNYFLYHLLG
AENVIVVPNGADLMEEMHKAAKEVSEKGNTPYVIPVGGSNPTGAMGYVACAQEIIAQSFD
QGIDFSSVVCVSGSGGMHAGLITGFAGTQSNIPVIGINVSRGKAEQEEKVAKLVDETSAH
VGIPNFIPREAVTCFDEYVGPGYALPTPEMVEAVQLLAKTEGILLDPVYTGKAVAGLIDL
IRKGTFNKEDNILFVHSGGSPALYANTSLFA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagctaaattcccgagaaaaaaatatacagagtcatatacaccaattgaaaaa
ttaaacaatttttcagaagcacttggtgggccgactatttattttaaacgagatgattta
cttggtttaacagctggtggtaataagacgagaaagttagagtttttagttgcggatgca
caggcaaagggtgcagatacgttaattacagctggtggtattcagtcaaatcattgccgc
ctaacacttgcagcggcggtaaaagaaaaaatgaaatgtatccttgtattagaagaaggg
cttgagccagaagagaagccagactttaatggaaactatttcttatatcatttactaggt
gctgaaaatgtcattgttgtaccgaacggagcagatcttatggaagagatgcataaagcc
gcgaaagaagttagtgaaaaagggaatacaccatatgtcattccggtcggtggatcgaat
cctactggagcaatgggatacgttgcttgtgcgcaagaaattatagcgcaatcatttgac
caaggaattgatttcagttcagtcgtttgcgtaagtggtagcggcggtatgcacgctggt
ttaattacaggttttgctggaacacaaagtaacatccctgtaatcggaattaacgtaagt
agaggaaaagcagagcaagaagagaaagtagcaaaacttgtagatgaaacgtcagctcat
gttggtattccaaactttatcccgcgcgaagcggttacatgctttgatgaatatgtagga
ccgggttacgcgttaccaacgccagaaatggtggaagcagtgcagctgttagcaaaaaca
gaaggtattttacttgatccagtatatacaggtaaagcagtagcgggattaatcgactta
attagaaaaggtacatttaataaagaggataacattttattcgtacattcaggtggttca
ccagctttatatgcgaatacatctttattcgcgtaa

DBGET integrated database retrieval system