KEGG   Bacillus anthracis Ames: BA_3566Help
Entry
BA_3566           CDS       T00129                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ban  Bacillus anthracis Ames
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BA_3566
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BA_3566
  Lipid metabolism
   00071 Fatty acid degradation
    BA_3566
  Amino acid metabolism
   00350 Tyrosine metabolism
    BA_3566
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BA_3566
   00626 Naphthalene degradation
    BA_3566
Enzymes [BR:ban01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BA_3566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
3271028..3272026
Genome map
AA seq 332 aa AA seqDB search
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPL
ILGNDFAGVIIKVGSKVTRFKIGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEE
AASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGP
DLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNA
RFSKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKP
VIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgataattgataagtatggaaaagtcccaatgcgtatggccgaggtacct
attcctgaaataaatgagcatgaagtgctcgcagaaattcatgcagctagtattaaccca
attgattttaaaatacgcgatggaaaagtaaagatgttactgaaatatgaaatgccccta
atccttgggaatgactttgccggtgtcatcataaaggttggatcaaaagtaactcgtttt
aaaatcggtgatgaaatatatgcacgtccaagaaaaaataagattggtactttcgcggag
tatatagctattcatgaagatgatatagctttaaaaccgaaaaatttaagttttgaagaa
gctgcttcaattccacttgttggcttaacatcatatcaagcattacatgacattatgcaa
ttacaaaaagatcaaaagattttaattcacgctggatctggtggtgttggtactttcgca
attcagctagcaaaaataatgggtgctaccgttacaacaactgctagtgaagctggtccc
gatttagtaaagtctcttggagcagatcaaattattaattacaaaacagaaaaatttgaa
gaaatactaaaagattatgatgcagtatttgataccattggtggtacaacacttgaaaaa
tcattcgatattataaaaagcggcggcaacattgtttccgtttcaggaataccaaatgct
cgtttcagtaaagaatttggttctggattttttaaaacattcttattttcattagcaagt
aaaaaacttactgcacttgaaaaaaagcataatgctcaatattcatttttatttatgaag
ccaagcggagatcaattacgtactatcgcaaactatattgaagccggaaaaatcaaaccg
gtaatcgatcgagttttcccttttgaagatgcgcaaaaagcaatggaatattcagaggcc
ggaagagcaaaaggaaaaataattgtgaaaatgaaataa

DBGET integrated database retrieval system