KEGG   Bacillus anthracis Ames: BA_4333Help
Entry
BA_4333           CDS       T00129                                 

Gene name
ribBA
Definition
bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II (EC:3.5.4.25)
Orthology
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
ban  Bacillus anthracis Ames
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:ban00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
3956092..3957285
Genome map
AA seq 397 aa AA seqDB search
MFHRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPIT
EGYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFN
RPGHIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCA
KQFDIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGD
ISTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLL
NKLRAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQ
GYDLTVTERVPLQMPAKEENKTYLQTKVNKLGHLLNL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatcgtattgaagaagctctagaagatttaaaacaaggaaaagtcgttatcgta
tgtgatgatgaaaaccgtgaaaacgaaggcgattttatcgctttagcagagtatattacg
cccgaaacaattaactttatgattacacatggacgcggtctcgtttgtgtaccgattacg
gaaggatacgcagaacgtctacaattagaaccaatggtatctcataatacagattcgcat
catactgcatttacagtgagcattgaccatgtttctacaacaacaggcattagcgctcac
gaacgtgcaactacaatacaacaattgttaaatcctgcatcaaaaggtgctgatttcaat
cgacctggacatatctttccattaatcgcgaaagaaggcggtgtcctgcgtcgtgctggt
catacagaagctgctgtcgatttagcacagctttgcggagcagaaccagctggagtcatt
tgcgagattatcaatgaggacggtacgatggcacgcgtccctgatttactacagtgtgca
aaacaatttgatataaaaatgattacaatagaagatttaattgcttatcgccgccatcat
gaaacacttgtgacgagagaagtggaaattacattacctacagatttcggtacttttcaa
gcaattggctattctaactcattagatacgaaagaacatattgcactcgtaaaaggtgat
atttcaacaggtgagcctgtacttgtacgcgttcattcagagtgcttaacaggagatgta
tttggctcgtgccgctgtgattgcggaccacaactccatgctgcacttgctcaaattgaa
cgtgaaggaaaaggcgttcttctttatatgagacaagaaggacgaggcattggccttctt
aataagcttcgcgcttataagttacaagaagaaggcttcgatactgtagaagcaaacgaa
aaacttgggtttcccgctgaccttcgtgattacggtatcggcgctcaaatattaaaagat
ttaggtttacaacatttacgattattaacgaataatccaagaaaaatcgctggcttacaa
ggttacgatttaaccgttacggagcgcgtaccgttgcaaatgccagcaaaagaagagaat
aaaacgtatttacaaacgaaagtaaacaaattaggacatttattaaacttataa

DBGET integrated database retrieval system