KEGG   Bacillus anthracis Ames: BA_4386Help
Entry
BA_4386           CDS       T00129                                 

Gene name
buk
Definition
butyrate kinase (EC:2.7.2.7)
Orthology
K00929  
butyrate kinase [EC:2.7.2.7]
Organism
ban  Bacillus anthracis Ames
Pathway
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BA_4386 (buk)
Enzymes [BR:ban01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.7  butyrate kinase
     BA_4386 (buk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4000122..4001225)
Genome map
AA seq 367 aa AA seqDB search
MSVNRILVINPGSTSTKIGVFDNERPVLEETIRHDEEQIGKYKRIIDQYEFRKETILEVL
HSHGINISKLNAVCGRGGLLRPIEGGTYTVNDAMLEDLKNGFSGHHASNLGGILAYEIAS
GLNIPAFIVDPVVVDEMEPIARISGIAGMERKSIFHALNQKAVARKVAEELNHKYEDLNL
LVTHMGGGITVGAHKKGKVIDVNNGLNGEGPFSPERAGTVPVGQLVEMCFSGEYYRDEMV
KKLVGQGGLVSLIGTNDAIKVEQMVEKGDPEATLIYKAMAYQVAKEIGGASAVLHGKIDA
IVLTGGLAYSKILVDEIKERVDWIADVIVHPGEDELQALAEGALRVLREEEAPKEYIVRE
KETVARG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtaaatcgaattcttgttattaatccgggtagtacatccacaaaaattggtgtt
tttgataatgaaagacccgttttagaagaaactattcgtcatgatgaagaacagattgga
aaatataagcgaattatcgaccaatatgagtttcgtaaagaaacgatcttagaagttcta
cattctcacggtattaacatttcaaaattaaacgcagtttgtggacgcgggggattactt
cgtccaatcgaaggcggaacatacacagtaaacgatgcgatgttagaagatttaaaaaat
ggttttagtggtcatcacgcttcaaaccttgggggcattttagcatatgaaatagcttct
ggattaaatattccggcattcattgtagatcctgtcgttgtagatgaaatggagccgatt
gctcgtataagtggtattgctggtatggaacgtaaaagtattttccatgcattaaatcaa
aaagcagttgctcgtaaagtagctgaagaattaaaccacaaatatgaggatttaaattta
ttagttacacatatgggcggcggtattacagttggtgctcataaaaaaggaaaagttatc
gatgtgaataatggcttaaacggagaaggaccatttagcccagagcgtgctggtacagta
ccagtaggacaactagttgaaatgtgtttctctggtgagtattaccgagatgaaatggtt
aaaaaacttgtcggacaaggtggacttgtaagtcttatcggtacaaatgatgcgattaaa
gtagaacaaatggttgaaaaaggtgatcctgaagcaactcttatttataaggcaatggca
tatcaagttgcaaaagagattggcggagctagcgctgtacttcacgggaaaatcgatgca
atcgtattaactggtggacttgcttatagtaaaattcttgttgatgaaataaaagaacga
gtagactggattgcagatgttatcgtacatccaggagaagatgaattacaagcattagca
gaaggggcacttcgtgtactacgtgaagaagaagctccaaaagaatatattgtacgtgaa
aaagaaacggtagctaggggttga

DBGET integrated database retrieval system