KEGG   Bacillus anthracis Ames: BA_4386Help
Entry
BA_4386           CDS       T00129                                 

Gene name
buk
Definition
butyrate kinase (EC:2.7.2.7)
Orthology
K00929  
butyrate kinase [EC:2.7.2.7]
Organism
ban  Bacillus anthracis Ames
Pathway
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ban00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(4000122..4001225)
Genome map
AA seq 367 aa AA seqDB search
MSVNRILVINPGSTSTKIGVFDNERPVLEETIRHDEEQIGKYKRIIDQYEFRKETILEVL
HSHGINISKLNAVCGRGGLLRPIEGGTYTVNDAMLEDLKNGFSGHHASNLGGILAYEIAS
GLNIPAFIVDPVVVDEMEPIARISGIAGMERKSIFHALNQKAVARKVAEELNHKYEDLNL
LVTHMGGGITVGAHKKGKVIDVNNGLNGEGPFSPERAGTVPVGQLVEMCFSGEYYRDEMV
KKLVGQGGLVSLIGTNDAIKVEQMVEKGDPEATLIYKAMAYQVAKEIGGASAVLHGKIDA
IVLTGGLAYSKILVDEIKERVDWIADVIVHPGEDELQALAEGALRVLREEEAPKEYIVRE
KETVARG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtaaatcgaattcttgttattaatccgggtagtacatccacaaaaattggtgtt
tttgataatgaaagacccgttttagaagaaactattcgtcatgatgaagaacagattgga
aaatataagcgaattatcgaccaatatgagtttcgtaaagaaacgatcttagaagttcta
cattctcacggtattaacatttcaaaattaaacgcagtttgtggacgcgggggattactt
cgtccaatcgaaggcggaacatacacagtaaacgatgcgatgttagaagatttaaaaaat
ggttttagtggtcatcacgcttcaaaccttgggggcattttagcatatgaaatagcttct
ggattaaatattccggcattcattgtagatcctgtcgttgtagatgaaatggagccgatt
gctcgtataagtggtattgctggtatggaacgtaaaagtattttccatgcattaaatcaa
aaagcagttgctcgtaaagtagctgaagaattaaaccacaaatatgaggatttaaattta
ttagttacacatatgggcggcggtattacagttggtgctcataaaaaaggaaaagttatc
gatgtgaataatggcttaaacggagaaggaccatttagcccagagcgtgctggtacagta
ccagtaggacaactagttgaaatgtgtttctctggtgagtattaccgagatgaaatggtt
aaaaaacttgtcggacaaggtggacttgtaagtcttatcggtacaaatgatgcgattaaa
gtagaacaaatggttgaaaaaggtgatcctgaagcaactcttatttataaggcaatggca
tatcaagttgcaaaagagattggcggagctagcgctgtacttcacgggaaaatcgatgca
atcgtattaactggtggacttgcttatagtaaaattcttgttgatgaaataaaagaacga
gtagactggattgcagatgttatcgtacatccaggagaagatgaattacaagcattagca
gaaggggcacttcgtgtactacgtgaagaagaagctccaaaagaatatattgtacgtgaa
aaagaaacggtagctaggggttga

DBGET integrated database retrieval system