KEGG   Bacillus anthracis Ames: BA_4622Help
Entry
BA_4622           CDS       T00129                                 

Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ban  Bacillus anthracis Ames
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ban00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BA_4622
Enzymes [BR:ban01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BA_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(4197979..4200291)
Genome map
AA seq 770 aa AA seqDB search
MFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPRMHEDEVFT
LTGHFKDHPKYGKQYLVETFKKELPQTKAGMAQYLASDLFKGIGKRTAEKIVAHLGEHAI
SKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKIYQQYKEMT
LEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVSLQLGHVYM
RKDQLVRETMSLLNNQEGRVTEEDIISCIEMMQSEGKVIIEEERVYLASLFYSEKGVVKS
IRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPLQQEAIQTALHKPMMLLTGGPGTGK
TTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLPACTIHRLL
GWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGDEDQLPSVG
PGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQKDRSFIGCT
GAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPKREKSKEIA
YGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFDGIEVTYTK
PDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKFLIICGEEA
AFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaggaagaaaaaaagtttataaaagcgcaagttcttcataccattttccacaac
gaagaaaacctctattccgttgtcagtatgaaagtcattgaaacgaatgaaacgtacgac
gaaaaaaaagtgatgataaacggtcattttccccgcatgcatgaagatgaagtgtttacg
ttgacaggacattttaaagaccatccgaagtatgggaaacaatatttagttgaaacgttt
aagaaagaattgccgcaaacaaaagcaggtatggcgcaatatttagcgagtgatctattt
aaagggataggaaaacgcacagctgaaaaaattgtggcccatctaggggaacatgctatt
tctaaaatcatggatgatcctgaggctttaaacggtgttgttaacaaacaaaaagcgcaa
gaaatatatgagacaattgttgaacatcaaggattagagaaagtaatgagttttttaaat
ggttacggttttggaacgaagctttctattaagatttatcagcaatataaagagatgaca
ttagaagtaattcgtaataacccatatcagcttattgaagaagtggatgggattggattt
ggaagagcggatgatatcggacgtgcgttagggatatcgggtaatcatgatgatcgtgta
cgtgcgggatgtttttatacgttagagaatgtgtcattacaacttggtcacgtttatatg
agaaaagatcaacttgtaagagaaacgatgtcacttttaaataatcaagaaggaagagtg
acagaggaagacattataagctgtattgaaatgatgcaaagtgaagggaaagtcatcatc
gaagaagagcgagtatatttggcatcgttattctattctgaaaaaggtgttgtgaagtct
attcgcaggctcatgaatcaggaagaaacaccttcatttcctgaagcagaagtgttaaag
acgttaggtgaaattgaagaacaattgaacgtacagtatgcgccgcttcagcaagaagca
attcaaacggcacttcataaaccgatgatgttattgacaggtggaccaggaacaggaaaa
acaacagttattaaaggaattgttgaaatgtatgcgtcacttcacgggctatcgttaaat
ccgaatgaatatagtgatgataatccatttccgatactattaacagctccaacaggaaga
gcagcgaagcgaatgagtgaatcaacagggcttccagcttgcacaattcaccgtttactt
ggatggacgccagaagggtctttccagcgtaatgaaacagatccggtacaagggaaatta
ctcattattgatgaattttcaatggttgatatttggcttgcaaatcagctgtttaagtca
ttgccgactaacattcaagttatcgttgtaggcgatgaagatcaattaccatctgtagga
cctgggcaagtattgaaagatttattaaatgcaggtgcagttccaacagtaaagcttact
gaaatttatcgtcaagcggaaggttcatcagtgattcaacttgcccatgcgataaaaaat
ggaacgctcccaccagatttagcgcaaaatcaaaaagatcgttcatttatcggctgcaca
ggagctcaaattgttgaagttgttaagaaggtttgcgaaaacgctaagacaaaagggttt
agcgcaagagatgtacaagtattggccccgatgtatcgtggaccggctggtattaatgta
ctaaatgaagcgttgcaagaagtgtttaatccgaaaagagaaaagagtaaagaaattgct
tacggtgatgttgtataccgaagaggcgataaagttttgcaactcgttaatcagccagag
agccaagtatttaatggtgatatcggcgaaattgtttcggtgttttatgcgaaagaaaac
gttgagcaacaagatatgattatcgtttcatttgatggaattgaggtaacatatacaaaa
ccagatttaaatcaaattacacatgcttattgctgttccattcataaatcgcaaggtagt
gagtttcccattgtgattatgccgatagtgaaaagttataatcgtatgttacgtcgtaat
ttaatttatactggtattacaagaagtaagaagttccttattatttgcggggaggaagct
gcttttcagtctggtgtaaatcgccttgatgatgcaatgcgtcaaacgactttagctagc
cgcttgcaagaatcacaaggagaagtacagatggtaacggttaatggcgaagagatggac
gtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system