KEGG   Bacillus anthracis Ames: BA_4896Help
Entry
BA_4896           CDS       T00129                                 

Definition
(RefSeq) acyl--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00010  Glycolysis / Gluconeogenesis
ban00620  Pyruvate metabolism
ban00640  Propanoate metabolism
ban00680  Methane metabolism
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01130  Biosynthesis of antibiotics
ban01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BA_4896
   00620 Pyruvate metabolism
    BA_4896
   00640 Propanoate metabolism
    BA_4896
  Energy metabolism
   00680 Methane metabolism
    BA_4896
Enzymes [BR:ban01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BA_4896
Lipid biosynthesis proteins [BR:ban01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BA_4896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 1086732
NCBI-ProteinID: NP_847096
Position
complement(4448149..4449717)
Genome map
AA seq 522 aa AA seqDB search
MAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIKSGLQKG
DKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSYEPYIGQ
FDDIEAMESLQKFVLSERSVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTSGTTGNP
KGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGATGFVYH
GKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPLNREVIE
TFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVDEEGMPVRVGEV
GDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDDIIISSG
YTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIPILQQHV
KELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttggcaccaccgtcttataatttagtttctgaaatagagaaatatacaggtgataaagag
aagcttgctttaatttggcaagatgataaagggaatcgacgagaagttacatacgctgag
ctaatgaaaggtgcaaataaaattggaaacgcttttataaagagtggtctgcaaaaaggg
gacaagctcctcattatgatgccgcgtttaattgaagcgtacatgacgtatatcgcagcg
attaaagcaggatttgtcgtaattccgagttcggaaatgttacgcaaaaaggatatcgaa
tatcgcattggacacggggaagtaaaagcaatcgtaagttatgagccttacattggacag
tttgatgatatagaagcgatggaatcccttcaaaagttcgttctgagcgagcggtcagta
gatggatggatcaatttaaaaacagcgttagaaacagaaagtgacatgttagaaatggcg
aagacagataaagaagatatggtctttttatcttacacgtcaggaacgacaggaaatcca
aaaggtgttgttcatacgcatgcgtgggcatacgctcatttacgtacaagcgctccgaat
tggctcggaattgaagagaatgatgttgtatgggcaacagctagtccaggctggcagaag
tggatttggagcccgtttttagcaactctaggctcgggggcaacaggatttgtataccac
ggtaagtttgaaccaaaaacgtatttaaatttattagacgataataaggtgaatgtactt
tgttgtacgccaactgagtatagattaatggcaaaagtagaaaatttaagcgagtacaat
ttagaagcgttacatagcgctgtatccgcaggtgagccgttaaatagagaagtcattgaa
acgttccaaaagcactttcatattacagtgagagacggctatgggcaaacggaaaataca
ttgcttgttggtgtaatgaaagggatggatattagaccaggatcaatggggaaaccgacg
ccaggcaaccacgttgatattgtagatgaggaagggatgccagtaagggtaggcgaagtt
ggtgatattgcggttcatattgaaacaccagccctctttaaacaatactataaagacgat
gagcgcacagcgatgcaattccgcggtgattattatattaccggtgataaagcaaagaaa
gatgaagacggctatttctggtttgaagggcgcggtgatgatattattattagctctggt
tatacaatcgggccgtttgaagtagaagatgcgctcgtaaagcacccttatgtaagagaa
tgtgcggttgtcgcaagtcctgatgaaattcgcggaagtgtcgtgaaggcatttatcgta
ttaagagagaatatagaaaagaacgaagaaacattaattccaatactccaacaacacgtc
aaggaacttactgcaccatataaataccctcgcaaaattgaatttgtagatgaactacca
aaaacgatttctggaaaaatccgccgtattgaacttagaaaacaagagatggagattccg
tcaaaataa

DBGET integrated database retrieval system