KEGG   Bacillus anthracis Ames: BA_5009Help
Entry
BA_5009           CDS       T00129                                 

Definition
(RefSeq) hypothetical protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BA_5009
Enzymes [BR:ban01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BA_5009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 DUF676 LCAT Ser_hydrolase PGAP1 Abhydrolase_3 LIDHydrolase Abhydrolase_5 DUF900 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 1084260
NCBI-ProteinID: NP_847203
Position
complement(4546936..4547739)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFNNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagctgaagaagcaaaggctgtaatcgttatcgtgcacggcgcaatg
gaatatcacggacgctatgaagccgttgcggaaatgtggaatcatatcggctaccatgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattcg
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtatcggtta
cctatttttctatttggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagacggcattattttaagttcgccatgtttaggtgtattagct
ggaccttctgcaccgcttcaagctgcctcaaaaatattaaatattatcgctccgaagtta
caatttgcaacgaatcttacagtggaaatgtcaacgcgtaatcatgaagtgagagatgcg
atggagaacgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctattgaaatcgctcataaaaaaatagatgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttaataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system