KEGG   Bacillus anthracis Ames: BA_5123Help
Entry
BA_5123           CDS       T00129                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ban  Bacillus anthracis Ames
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ban00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(4645408..4647345)
Genome map
AA seq 645 aa AA seqDB search
MSVINCEEVKRDEFHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEW
DYEQHKMLQVTEEGIWSLFIPHIEEREIYKYAIETMAGDVIFKADPYAVYAEVRPNTASV
VFDIKGYEWNDKNWSRKKKKKSVYKEAMTVYELHFGSWKKKEDGTLYSYREMAEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRY
FHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLV
TAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHDKMTFSLLYAYSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSREGFQWIDANNNEQSIFSFIRQGDKQ
EDALVVVCNFTKATYENYKVGVPDFEYYNEVLNSDAEQYGGSGQVNKKRLKTFQEPYHNQ
TAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtaataaattgtgaagaagtgaaacgagatgagtttcataccgaaaagtactat
gaaagttataacatctttggcgcacatattgtgacggaagatgagatgcgaggtgtacga
tttacagtatgggctcctcatgcgaaagcaatgagtgttgttggagattttaatgaatgg
gattatgagcaacataagatgctgcaagtgacagaagagggaatttggtccctatttata
ccgcatatagaagaaagagaaatatataaatatgcgattgaaacgatggctggtgatgtc
atttttaaggcagatccgtatgctgtgtatgcagaagtaagaccgaatacggcatctgta
gtttttgatataaagggatatgaatggaatgataaaaactggagccgtaagaaaaagaaa
aaatcggtttataaagaagcgatgacagtttatgaattacatttcggttcttggaaaaag
aaagaagatggaacactgtattcttacagagaaatggcagaagaactcattccttatgtg
gtggaacatcaatttacacatattgaaattatgccgcttgttgagcatccatatgatcgt
tcttggggatatcaagggacgggatattatgcagcaacgagtagattcggcacgccacat
gatttgatgcattttgtcgatgaatgtcataaatatggaatcggtgtcattttagattgg
gtgccggggcatttttgtaaagatgctcacggtttatatttgtttgatgggacaccgact
tatgaatataaagataaagatgtgcaagaaaatccagtatggggaactgttaactttgat
ttaggaaagagggaagtacgtaatttcttaatttcaaatgcgttattttggatgcgatat
ttccatattgatggtttcagggtggatgcagttgcgaacatgctgtactggaataaagaa
ggacaagagcaaagtaatgagcacgctgtttcctttttacgagagttaaatgaagcggtg
tttgcagaggatgaagattttcttatgacagcagaggattcaacagcttggccacttgta
acagctccaacgtatgaaggtgggcttggattcaattacaaatggaatatgggctggatg
aatgacgtgctgaaatatatggaatgtgcgccagagtacagaaaatatattcatgataaa
atgacgttctctttactatatgcttactctgaaaatttcatattaccgctttctcatgat
gaagtcgttcatgggaaaaagtcgttattaaataaaatgccaggagactactgggataag
tttgctcaacttcgtttattatatggatatttctttactcacccaggaaagaaattactt
ttcatgggaggagaattcgggcagtttgatgagtggaaagaccttgaagatttagattgg
aatttacatgattttgaaatgcatcgttatatgcatgattactttaaagagctcatagca
ttgtataagcgctctaaaccactttggcagcttgatcattcgcgtgaaggatttcagtgg
attgatgctaataataatgagcaaagtattttctcttttatccgccaaggggataaacaa
gaagatgcgttagttgtcgtatgtaattttacgaaagctacatatgaaaactataaagta
ggtgtaccagatttcgagtattataacgaggttttaaacagtgatgctgagcaatatggc
ggatcagggcaagtaaataagaaacgtcttaagacgtttcaagaaccgtatcataatcaa
acagcacatgtagaaattacaattccaccatttggcgtatccatattacgaccagtgaag
acgagaaaggggagcaaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttact
agcagggggaaaaggtag

DBGET integrated database retrieval system