KEGG   Bacillus anthracis Ames: BA_5152Help
Entry
BA_5152           CDS       T00129                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ban  Bacillus anthracis Ames
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BA_5152 (gtaB)
   00052 Galactose metabolism
    BA_5152 (gtaB)
   00500 Starch and sucrose metabolism
    BA_5152 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BA_5152 (gtaB)
Enzymes [BR:ban01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BA_5152 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(4677165..4678052)
Genome map
AA seq 295 aa AA seqDB search
MKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEG
RRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQTNQES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gctacaaaagcaatgccaaaagaaatgttaccgattgttgataaaccaactatccaatac
attgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaaacg
aagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttattagaa
aagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacattcac
tatatccgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcacgtaaattc
atcggtgatgagccatttgctgttttattaggtgatgatatcgttcaagctgaaaaacca
tgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgtacaa
acggttccagaagacgaaacacaccgctacggaattattgatccgttagagcaagaagga
cgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttcaaac
ttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaacaacaa
catgttggtgctggtggtgaaatccagttaacagatgctattcaaagcttaaacgaaatt
caacgtgtattcgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagctagga
ttcgttcaaacgacaatcgaaatggcactgcaacacccagaattacgtgatgacatggtt
acgatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

DBGET integrated database retrieval system