KEGG   Bacillus anthracis Ames: BA_5203Help
Entry
BA_5203           CDS       T00129                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00010  Glycolysis / Gluconeogenesis
ban00260  Glycine, serine and threonine metabolism
ban00680  Methane metabolism
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01130  Biosynthesis of antibiotics
ban01200  Carbon metabolism
ban01230  Biosynthesis of amino acids
Module
ban_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ban_M00002  Glycolysis, core module involving three-carbon compounds
ban_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BA_5203
  Energy metabolism
   00680 Methane metabolism
    BA_5203
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BA_5203
Enzymes [BR:ban01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BA_5203
Membrane trafficking [BR:ban04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BA_5203
Exosome [BR:ban04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BA_5203
  Exosomal proteins of melanoma cells
   BA_5203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3402 Fer4_12 NusB
Motif
Other DBs
NCBI-GeneID: 1084610
NCBI-ProteinID: NP_847386
Position
4722819..4723373
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKKQANTLATFLLEHHPQIDHIISSPFVRAIDSIRP
YARQANLSIQEDERLAERILSDVPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
QHVLKLNYTTTLLVTHGNLLTLILKYFDHTIGFHEWKALTNPDVYEIVIDEQCTIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgtcatacgacattgttcagcaactggccaagaacgtgatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattcctcttagagcaccat
ccacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcacgccaagccaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacgttccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggggagtcaacgaaacaagcaacggatcgtgctatatcgcttatc
caacacgttttaaaattaaactatactacaacactacttgttacacatggcaatttactt
acactcattttaaagtactttgatcatacgattggctttcatgaatggaaagctttaacg
aatcctgatgtttacgaaattgtaattgatgaacaatgtactataaaacgattatgggaa
gcatcatccaagtaa

DBGET integrated database retrieval system