KEGG   Bacillus anthracis Ames: BA_5366Help
Entry
BA_5366           CDS       T00129                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ban  Bacillus anthracis Ames
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BA_5366 (tpiA)
   01230 Biosynthesis of amino acids
    BA_5366 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BA_5366 (tpiA)
   00051 Fructose and mannose metabolism
    BA_5366 (tpiA)
   00562 Inositol phosphate metabolism
    BA_5366 (tpiA)
Enzymes [BR:ban01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BA_5366 (tpiA)
Exosome [BR:ban04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BA_5366 (tpiA)
  Exosomal proteins of bladder cancer cells
   BA_5366 (tpiA)
  Exosomal proteins of melanoma cells
   BA_5366 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4861236..4861991)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEVVSPAAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgcctggtagcagcgactgaaggaactgatttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagatgagtcagtaaacaaaaagactattgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagttgtttctcca
gctgctgcagaagctgttcgtatccaatacggcggtagcgtaaaaccagaaaacattaaa
gagtacatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system