KEGG   Bacillus anthracis Ames: BA_5684Help
Entry
BA_5684           CDS       T00129                                 

Definition
glycosyl transferase group 2 family protein
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
ban  Bacillus anthracis Ames
Pathway
Metabolic pathways
Brite
Enzymes [BR:ban01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     BA_5684
Glycosyltransferases [BR:ban01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   BA_5684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
5169623..5170594
Genome map
AA seq 323 aa AA seqDB search
MQKLISVVVPMYFEEEVAQECYNRLKSVMLQNDINYEFVFVNDGSTDRTMEILSEIAAND
YRTKIVNFARNFGHQVAVTAGIAAAKGDAIVIIDADLQDPPEVIPELIAKWEEGYEVVYA
KRKQRKGETWFKLLTAKYFYKFLNYMSDIDIPKDTGDFRIIDRKVADVFNQMTERNRFIR
GMMSWVGFRQTYVEYERDERFAGETKYPLKKMIKFASDGIIAFSTKPLRIVMSLGLLSVL
ISIIVLLYTITVKIIGNGTQTGWASIMVAITFFSGIQLLGLGIVGQYIARIYDESKNRPI
YIVKETINIDQEETALKKEKVNA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaatctcggttgtagttcctatgtacttcgaggaagaagtagcacaggaa
tgttataaccgtttaaagtccgttatgcttcaaaatgatattaattacgagtttgtcttt
gtaaacgacggtagtacagatcgtacaatggaaatcttatctgagattgcagcaaatgat
taccgtacaaaaatcgttaacttcgctcgtaactttggtcaccaagtagctgttacagct
ggtatcgctgctgcaaaaggtgacgctattgtaattatagatgcagacttacaagatccg
cctgaagttattcctgaacttattgcaaaatgggaagaaggatatgaagttgtttatgca
aaacgtaagcaacgtaaaggtgaaacttggtttaaacttttaacagctaaatatttctat
aagttcttaaactacatgtctgatatcgatatcccaaaagatactggtgatttccgaatc
atcgatcgcaaagtagctgatgttttcaatcaaatgactgagcgaaatcgcttcatccgc
ggtatgatgtcttgggttggcttccgccaaacgtatgttgaatatgaacgcgatgagcgc
tttgctggtgaaacaaaatatccattaaagaaaatgattaaatttgcatctgacggcatt
attgcattttcgacaaagccattacgcatcgttatgtctttaggtttattatcagttcta
atttctataattgtcttactatatacaattactgtgaaaattatcggcaatggtacacaa
acaggttgggcatctattatggttgctattacattctttagcggtattcaattacttggt
cttggaatcgttggtcagtatatcgctcgtatttatgacgaaagtaaaaaccgtccgatt
tatatcgtaaaagaaacaatcaacattgaccaagaagagactgcactgaaaaaagaaaaa
gtgaatgcataa

DBGET integrated database retrieval system