KEGG   Bacillus anthracis Ames: BA_5684Help
Entry
BA_5684           CDS       T00129                                 

Definition
(RefSeq) glycosyl transferase group 2 family protein
  KO
K20534  
polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
ban  Bacillus anthracis Ames
Brite
Enzymes [BR:ban01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BA_5684
Lipopolysaccharide biosynthesis proteins [BR:ban01005]
 O-antigen
  BA_5684
Transporters [BR:ban02000]
 Other Transporters
  Others
   BA_5684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
5169623..5170594
Genome map
AA seq 323 aa AA seqDB search
MQKLISVVVPMYFEEEVAQECYNRLKSVMLQNDINYEFVFVNDGSTDRTMEILSEIAAND
YRTKIVNFARNFGHQVAVTAGIAAAKGDAIVIIDADLQDPPEVIPELIAKWEEGYEVVYA
KRKQRKGETWFKLLTAKYFYKFLNYMSDIDIPKDTGDFRIIDRKVADVFNQMTERNRFIR
GMMSWVGFRQTYVEYERDERFAGETKYPLKKMIKFASDGIIAFSTKPLRIVMSLGLLSVL
ISIIVLLYTITVKIIGNGTQTGWASIMVAITFFSGIQLLGLGIVGQYIARIYDESKNRPI
YIVKETINIDQEETALKKEKVNA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaatctcggttgtagttcctatgtacttcgaggaagaagtagcacaggaa
tgttataaccgtttaaagtccgttatgcttcaaaatgatattaattacgagtttgtcttt
gtaaacgacggtagtacagatcgtacaatggaaatcttatctgagattgcagcaaatgat
taccgtacaaaaatcgttaacttcgctcgtaactttggtcaccaagtagctgttacagct
ggtatcgctgctgcaaaaggtgacgctattgtaattatagatgcagacttacaagatccg
cctgaagttattcctgaacttattgcaaaatgggaagaaggatatgaagttgtttatgca
aaacgtaagcaacgtaaaggtgaaacttggtttaaacttttaacagctaaatatttctat
aagttcttaaactacatgtctgatatcgatatcccaaaagatactggtgatttccgaatc
atcgatcgcaaagtagctgatgttttcaatcaaatgactgagcgaaatcgcttcatccgc
ggtatgatgtcttgggttggcttccgccaaacgtatgttgaatatgaacgcgatgagcgc
tttgctggtgaaacaaaatatccattaaagaaaatgattaaatttgcatctgacggcatt
attgcattttcgacaaagccattacgcatcgttatgtctttaggtttattatcagttcta
atttctataattgtcttactatatacaattactgtgaaaattatcggcaatggtacacaa
acaggttgggcatctattatggttgctattacattctttagcggtattcaattacttggt
cttggaatcgttggtcagtatatcgctcgtatttatgacgaaagtaaaaaccgtccgatt
tatatcgtaaaagaaacaatcaacattgaccaagaagagactgcactgaaaaaagaaaaa
gtgaatgcataa

DBGET integrated database retrieval system