KEGG   Bacillus anthracis HYU01: HYU01_23335Help
Entry
HYU01_23335       CDS       T03394                                 

Definition
(GenBank) cell surface protein
Organism
banh  Bacillus anthracis HYU01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NEAT Nucleoplasmin
Motif
Other DBs
NCBI-ProteinID: AIF58708
UniProt: A0A2P0HJR8 Q81L44
Structure
PDB: 

Jmol
Position
complement(4338430..4338888)
Genome map
AA seq 152 aa AA seqDB search
MFKQFKMIIAVFAVLFTFIATLGLQDAKAATKLADGKYNIAFTVWKGDKDESSRMNRYFE
SPATLTVKNGKQYVSFKVKDSTSIKSFQVEKDGQFVETTVLSENKKDNTRVVEFEVADLS
KKLNGKVKINIPIINYNASYDIRFVFDGNSIK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacaatttaaaatgattattgccgtatttgctgttttatttacgtttattgca
acactaggtttacaagatgcaaaggctgctacaaaactagctgatggaaaatataatatt
gcttttactgtatggaaaggcgataaagatgaatcgtctagaatgaataggtattttgaa
agcccagcaacattaacagttaaaaatggaaaacaatatgtttcatttaaagtgaaagat
agtacttctattaaaagtttccaagtagaaaaagatggtcaatttgtagaaacaaccgtg
ttaagtgaaaacaaaaaagataatactagagtagtagaatttgaagttgctgacttgtca
aaaaaactaaatggcaaggtgaaaattaatattccaattattaattataatgcttcatat
gatattcgctttgtatttgatgggaacagtattaaataa

DBGET integrated database retrieval system