KEGG   Bifidobacterium animalis subsp. lactis Bl12: Bl12_0043Help
Entry
Bl12_0043         CDS       T02712                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bani  Bifidobacterium animalis subsp. lactis Bl12
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bani00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bl12_0043
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bl12_0043
Enzymes [BR:bani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Bl12_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53582..55105
Genome map
AA seq 507 aa AA seqDB search
MKALKTTVHYDVTAGRTHTEQTELSVMDEAMNTEHIVESNVVGIYPDYTFQMMEGYGCSL
TESACYLLSKMDSATRKEALAQWFGPAGMDAWFVRVHIDSCDYSLSEYQAVEDPLADPEL
ETFSIDRDRQYILPVLKEAMAMAGHPIHVLLSPWSPPAQWKTPPEMTRNDASVYGGEEGD
VIDLSKPGRCFGGRLKPEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAAAATSWDSCL
WTGDQEREFLKHHLYPAMEEAGLTDAVKIFIWDHNKERAIEHIDEFMSDPEAAKEVGGFA
YHWYSGDHFEALSMLRGKYPDKVLMHSESCGLHIPGKVTMLDMTDEQIEALPDGDYKTMV
QTTTPNEMDFNDATAYAHDIIGDLNHGMQRWIDWNMIVDRQGGPRHTPGGFAAPIVAEDD
GRYTLTISYRYIREIAQAIKPNAVVLGTSTYSRDIEAVSARNADGSIGVVLLNQAERDIP
VNIRMGGLLVADVPLPARTLSTLVFTE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctcaagaccactgtgcactacgatgtgaccgccgggcgaacccataccgag
cagacggagctctcggtcatggacgaggcgatgaacaccgagcacatcgtcgaatcgaat
gtggtgggaatctacccggactacacgttccagatgatggagggctatggttgctcgctc
accgagtcggcatgctatctgctctccaaaatggactccgcgacgcgcaaagaggccttg
gcccaatggttcggtcccgctggaatggacgcttggttcgtccgcgtacacatcgactcc
tgtgattactcgctcagtgagtaccaggccgttgaggatcctctggccgatcccgaattg
gagaccttctcgattgaccgtgatcgtcagtacattcttccggtgctcaaagaggcgatg
gccatggcggggcatcccattcatgtgttgctctccccatggtcgcctccggcgcaatgg
aagacgcccccggagatgacgcggaacgacgcctcggtgtacggcggcgaggagggcgat
gtcatcgatctgagcaagccggggcgctgtttcggcggaaggctcaagccggaatactat
tcgtcgtgggcgcggtacctcgtcagattcatcagcgcctatatggccgaaggtgttccg
gtgacgatgctgtcgattcagaacgaggcggctgcggccacgagttgggatagctgcctg
tggaccggagatcaggagcgcgaattcctgaagcaccatctctacccggcaatggaggag
gccggtctgaccgatgccgtgaagatcttcatctgggatcataacaaggaacgtgcaatc
gaacacatcgacgagttcatgagcgacccggaggcggcgaaggaggttggcggtttcgct
tatcactggtactccggcgaccatttcgaggcgctgtcgatgttgcgaggcaagtatccc
gacaaggtgctgatgcattccgaaagctgtgggctgcatatacccggcaaggtgaccatg
ctcgatatgaccgatgaacagatcgaggcgctgcccgatggcgactacaagaccatggtg
cagacgaccactccgaacgagatggacttcaatgatgcgacggcctatgcccacgacatc
atcggcgacctgaaccatggaatgcagcggtggatcgactggaacatgatcgtcgacagg
cagggtggtccccgtcataccccagggggtttcgccgcgccgatcgtcgccgaagacgac
ggacggtatacgctgaccatcagctaccggtatattcgcgagattgcacaggccatcaaa
ccgaatgcggtggttctcggcacaagcacgtattcgcgtgatatcgaggcggtctcggcc
cgcaacgcagatggctcaatcggcgtcgtcctccttaatcaggcggagcgcgatatcccg
gtgaacattcgcatgggcggcctgcttgtggcggatgtgccgttgccggcacgcaccttg
agtactctggtgttcacggagtga

DBGET integrated database retrieval system