KEGG   Bifidobacterium animalis subsp. lactis Bl12: Bl12_0347Help
Entry
Bl12_0347         CDS       T02712                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bani  Bifidobacterium animalis subsp. lactis Bl12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bani00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455692..457860
Genome map
AA seq 722 aa AA seqDB search
MAELNEESPERLARPLIRLAQSLGVATSYVGMSRDFHEIPDDVLVAVLKALNVDASSEET
IEVSLEHVNNQRAMRLIEPTVLHIVGEQSHVPIHLAITEAPKVTITLEDGTIYQHDIAVE
PLPDVKVHEVNGKFFSTAQIALPADLPEGYHTLHIAAGQREADATLISAPQRIPLLDPLK
NGSLWGWMAQLYSIRSADSWGVGDFADLRTLLIDSKRYTNADFMLINPVHAGEPVSPLTP
SPYLPVSRRFINYTYIHPEDIPEYYALDDAAKQSVKDAHAKMEAYNADPNLIDRDAMWLE
KEKALRTIFNTGLQSVRQQAFDDYKARCGEDLEAYATWCVCYAKWGKPENTPDNWINKYT
KDSPEVKQLREQNSDLLEFYRWLEWIAVEQMHAAQQAARQAGMKIGIMSDMAVGVHPDGS
EVWWNPERFANGATVGAPPDMFNQQGQNWSQPPLSPLSLKETGYKAYREMVRGMFDCAGA
VRIDHILGLFRLWWIPEGQPASNGTYVYYDHNTMLGILAIEADRVGGLIVGEDLGVVPSY
VQQSLADYAIFGCAVEWFEQMDGVFIPPKDWRPYALASVDNHDMPPAAGYLEYEHVRVRE
QLGLLGEDSSAFERSARAEHQAMLQMLVDNGYLDVNVMKDESGRWEEIVEALYRALNSSP
CKLKAVSFVDAVGERRTQNQPGTDNEYPNWRVPLADYHGDNVPLEHLFDSDLLQRIAKIM
NS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactcaacgaagaaagcccggagcgtcttgcgcgcccccttattcgtctcgcg
cagtcgctgggcgtggcgaccagttatgtcggcatgtcgcgtgatttccatgagattccc
gatgacgtgctcgtggccgtgctgaaggccctgaatgtcgatgcctccagcgaggagacc
atcgaagtgtcgttggaacatgtgaacaaccagcgcgccatgcggctcatcgaacccacc
gtgctgcacattgtgggcgagcagagtcacgtgcccatccatctggccatcaccgaggcg
ccgaaggtcacgatcacactcgaagacggcaccatataccaacacgacatcgcggtggag
ccgctgcccgacgtcaaggtgcatgaagtcaacggcaagttcttctcgacggcgcagatc
gcactgcctgccgacctgcccgagggctaccacacgctgcatatcgcggcagggcagcgc
gaggcggatgcgacgctgatcagcgcgccacagcgcatcccactgctcgatccgctcaag
aacgggtcgttgtggggctggatggcccagttgtattcgatccgctcggccgactcctgg
ggcgtcggcgatttcgccgatctgcgcacgttgctcatcgactcgaagcggtacacgaac
gccgacttcatgctcatcaaccctgtgcatgccggcgaaccggtctcaccgctgaccccg
tcgccatacctaccggtgtcgcgtcgcttcatcaactacacctacattcacccggaggac
attccggagtactacgcgttggacgatgccgccaagcagtccgtcaaggacgcgcacgcc
aagatggaggcctacaacgccgatccgaacctgatagaccgcgatgccatgtggctggag
aaagagaaggcgctgcgcacgatcttcaacacgggcctgcagtcggtgcgccagcaggcc
ttcgacgactacaaggccaggtgcggcgaggacctcgaggcatacgccacctggtgcgtc
tgctatgcgaagtggggcaagccggagaacacgccagacaattggatcaacaagtacacg
aaggattcccccgaggtcaagcagctgcgcgagcagaacagcgacctgctcgaattctac
cgttggctcgagtggattgcggtcgagcagatgcatgcggcccagcaggcggcacgtcag
gccggcatgaagatcggcatcatgagcgacatggctgtgggcgtgcatcccgacggctcc
gaggtgtggtggaacccggagcgattcgccaatggcgccaccgtgggtgcgccgccggac
atgttcaaccagcaggggcagaactggagccaacccccgttgagcccgctgtcgctcaag
gaaaccggctacaaggcgtaccgcgagatggtgcgtggcatgttcgactgcgccggtgct
gtgcgcatcgaccacattctcggcctgttccgcctgtggtggatcccggagggccagccg
gcctcgaatggcacctacgtgtactacgaccacaacacgatgctgggcattctcgcaatc
gaagcagaccgtgttggtggtctgatcgtgggtgaggacctcggtgtcgtgccgtcgtac
gtgcagcagtcgctcgccgactatgccatcttcggctgcgccgtcgaatggtttgagcag
atggatggcgtgttcattccgccgaaggattggcgcccgtatgcgttggcctcggtggac
aaccacgacatgccgccggctgccggctatctcgagtacgagcatgtgcgcgtgcgcgag
cagctcggtctgctcggcgaggattcgtcggccttcgagcgcagcgcgcgcgccgagcat
caggccatgctgcagatgctcgtcgacaacggctacctcgatgtcaatgtgatgaaagac
gaatccggcaggtgggaggagatcgtcgaggcgctctaccgtgcgctcaacagctcgcct
tgcaagctcaaggccgtctccttcgtcgacgcggtgggagaacgccgcacgcagaaccag
ccgggcaccgacaacgagtatccgaactggcgtgtgccgttggccgactaccacggcgac
aacgtgccgctcgagcacctgttcgactccgatctgctgcagcgcatcgccaagatcatg
aacagctga

DBGET integrated database retrieval system