KEGG   Bifidobacterium animalis subsp. lactis Bl12: Bl12_0889Help
Entry
Bl12_0889         CDS       T02712                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bani  Bifidobacterium animalis subsp. lactis Bl12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bani00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1089079..1090581)
Genome map
AA seq 500 aa AA seqDB search
MAIDKPNHETMLQCFEWYLPESHNLWRWLSSQAPSVAHAGFTTAWLPPAYKGQAGDSDVG
YGVYDMYDLGEFDAKGSVPTKYGSRMEYLQAIRAMQGNGVRVFADIVFNHRMGADGTEPV
RTHEVNVDDRTRSDSTVVERTLNTVYDFPERGGVYSTFKWNWSDFTGTDYTTDDGTTGIM
RFDGKQWSDNVSHERGNFDYIMGDDVDVNEPEVARELTDWGIWYTTTTGVDGFRLDAVKS
IDAGFFAPWLRTMQRYGNHPGIAVGEYWSGDASELTSYLHDCNHCMMLFDVALHFRFEQA
SKNPEGFDLRGLAADTLYEREPTYACTFVDNHDTQPGQALESWVQPWFKPLAYACILLRD
NVLPCVFFGDYYGVPHDLIPPMRFLPHMVWIRAHLLGDQVEAQPGDTAHSLCWVVEGNHP
VCVVLNTGSSEVHRQVRNAALASHTLIDVCHPDAPATTDTQGQGMMRCPPRSCAIYIDAD
DYGVMLEALSGTPAAGTVCA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagacaaaccaaaccatgagaccatgttgcaatgcttcgaatggtacctgccc
gaaagccacaacctatggagatggctctcatcgcaggcgccgagcgtggcccatgccgga
ttcaccacagcttggcttccacctgcgtacaaggggcaggccggcgattcagacgtggga
tatggcgtctatgacatgtacgatcttggagagttcgatgccaaaggctctgttcccacc
aaatacggctcccgcatggagtaccttcaggcgattcgcgcgatgcagggcaatggtgtt
cgtgtattcgcggacatcgtgttcaaccaccgcatgggtgccgatggaacggaacccgtg
cgcacacatgaagtgaatgtggacgaccgcacgagaagcgactccaccgtggtcgaacgc
accttgaacaccgtatacgatttccccgaacgcggcggcgtgtattcgacattcaaatgg
aactggagcgatttcaccggcaccgattacacgaccgatgatggcacgacgggcatcatg
cgtttcgacggcaagcagtggagcgacaatgtgagccatgaacgcggcaacttcgattac
atcatgggagatgacgtcgatgtcaacgaacctgaggtcgccagagagcttacggattgg
ggcatatggtatacgacgaccacaggagtggacggcttccggctcgatgcggtgaaaagc
atcgacgccggattcttcgcgccatggttgcgcacgatgcaacgatacggcaatcatccc
ggcattgccgtgggtgagtactggtcgggtgacgcgagcgagctgacctcgtacctgcat
gattgcaaccattgcatgatgctgttcgatgtcgcgctccatttccgcttcgaacaggcc
tcaaagaacccagagggattcgatctgcggggacttgccgcagacacgctgtatgagcgt
gaaccgacgtatgcatgcaccttcgtggacaaccatgacacacaacccggtcaggcgctc
gaatcctgggtgcaaccatggttcaaaccgttggcgtacgcatgcattctgctacgcgac
aacgtgttgccttgcgtgttcttcggcgattactacggcgtaccccacgatctcatcccg
ccaatgaggttcctgccgcacatggtgtggatccgcgcgcatctgctgggggatcaggtg
gaggcgcagccaggcgataccgcccattcgctgtgctgggtggtggaaggaaatcacccg
gtgtgcgtggtgctcaacaccgggagcagcgaggtccatcgacaggttcgcaatgcggcg
ctcgcctcgcacacgcttatcgacgtatgccatcctgatgccccggcgacgactgacacg
caggggcagggcatgatgcgatgccctccgcggtcatgcgccatctatattgatgcggac
gattatggggtgatgttggaagcgttgtccggcacgcccgcagctgggactgtatgcgcc
tga

DBGET integrated database retrieval system