KEGG   Bifidobacterium animalis subsp. lactis ATCC 27673: BLAC_00295Help
Entry
BLAC_00295        CDS       T02862                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
banl  Bifidobacterium animalis subsp. lactis ATCC 27673
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:banl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLAC_00295
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLAC_00295
  Energy metabolism
   00680 Methane metabolism
    BLAC_00295
Enzymes [BR:banl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BLAC_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(63523..66279)
Genome map
AA seq 918 aa AA seqDB search
MTDQEQTITPADATIVSSGLGTKGPEERTLPATLQEDMDLCLNILRQVLSEYDENLLKTF
DTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDAQLLARAFATYFHLANL
CEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPAKAKELLERLEFHPVFTA
HPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKEDSRRLYSEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFHTIPMVYRRFDDWMLGDKAGIEPPACPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTPPSDELRALWNQQKEISERLT
GKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCDDFLADLRVVQRSLAEAGDKRA
AYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDIREHGLHGERGPLQPMTHEVLDT
FRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELNRLAFSNPDDAPVIDVIPLFEQLE
DLEHSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYSDSSKDAGPTTATLALHSAQERIAK
WADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPKGSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPMANQLSEVSHETFLDLLNSEDFAPWFS
IVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGSACESFG
DLATLRKAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDRPDLSKKVLDEMELTRKW
VLKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSESQQAGFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcaagagcaaacgatcacgccggccgacgccacgatcgtgtcgtccgggctc
ggcaccaaaggtcccgaagagcgcacgcttcccgcgacattgcaggaagacatggacttg
tgtctgaacattctgcgccaggtgctttccgaatacgacgagaatcttctcaaaacgttt
gacaccgtgcgtcagtatgccgtcgatgccagtgccgagcggttctccggcgtgctcacc
gacacgcatcccgaacgagacgacctagagatggccgtcaagacgatcgatgcgatgaat
ctgcacgatgctcagctgctcgcccgcgcgttcgccacgtacttccacctggcgaatctg
tgcgaggagaactaccgtgtggccgtgctccatgagcgcgaggccaaggtcgacgacacc
caggccatcgatccggtgaacgagatgacgaaggcctaccaccagctcatctccgaaatg
ggtccggccaaggccaaggagctgctcgaacgcctcgaattccacccggtgttcactgca
caccccaccgaggcgcgccgcaaggccgtggaaggcaagatccgccgcatcgcacagctg
ctcgaagcgcaccgtctgctcggcggctccgacaagaaggaggacagccgtcgcctgtac
agcgagatcgacgcactgttccgcacgtcgccgattgcgctgaagaagccgacgcctgtc
gaagaggccgacacgattctcgacatcttcgacaacacgctgttccacacgattccgatg
gtctaccgtcgtttcgacgactggatgctcggcgacaaggcaggcatcgagccgccggca
tgccccgcgttcttccacccgggcagctggatcggttccgaccgcgacggcaacccgaac
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccatgtgctcgccgcg
ctcgaggaggccacgcgcaccgtcggccgcaacatgaccgtcgaatccgagaccacgcca
ccgagcgacgaactgcgcgcgctgtggaaccagcagaaggagatcagcgagcgactcacc
ggcaaggcatcgctcatctccacgaaggagctgcatcgcgcggtgctgctcgtcatggcc
gaccgcctgcattacacgatcaagcgcgacaccgatctcatgtaccacaactgcgacgac
ttcctcgcggatcttcgcgtggtgcagcgttcgctcgccgaggccggcgacaagcgcgcc
gcctatggcccgctgcaggacctcatctggcagaccgagaccttcggcttccacatggtc
gaaatggagttccgccagcattcggtggtgcatgcgcgcgccctcgacgacattcgcgag
cacggcctgcatggcgaacgcggaccgttgcagccgatgacgcatgaggtgctcgacacc
ttccgtgccctcggcgcgatccagaagcgcaatggcgtcaaggccgcgcgccgctacatc
atctcgttcacgaagagcgcgaagaacgtgcgcgacgtgtacgagctcaaccgtctggcg
ttctcgaatccggacgacgccccggtgatcgacgtgatcccgctgttcgaacagctcgag
gatctcgagcattcggtctcggtgctcgacgagatgctgaagattcccgaggtgcaggcc
cgactcaagcagaccggccgcaagatggaggtcatgctcggctactcggattcgtcgaag
gatgccggccccaccaccgccacgctcgcgctgcactccgcgcaggagcgcattgcgaag
tgggcggacgagaacgacatcgatctgacgctgttccacggccgcggcggcgccgtcggt
cgtggcggtggcccggccaaccgcgcggtgctcgcacagccgaagggttcggtcaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaatccggtgctc
gccatccgccacgtcgagtccgtggccgccgcgacgctgttgcagtcggctccgagcgtg
gagaagacgaacaccgagatgaccgagaagtacaagccaatggcgaatcagctcagcgaa
gtttcacatgaaacgttccttgatctgctcaacagcgaggacttcgcgccatggttctcg
atcgtcacgccgttgaccgagatcggcttgctgccgatcggttcccgccctgcgaagcgc
ggcttgggagccaagtcgctcgacgatctgcgtacgatcccgtggatcttctcgtgggcc
caggcccgcatcaacctcgccgcctggtatggcctcggctccgcatgcgagtcgttcggc
gacctcgccacgctgcgcaaggcatacgaggaatggccgctgttctccacgttcatcgac
aacatcgagatgtcgctggcgaagaccgacgaacgcatcgcgaagatgtaccttgcactc
ggcgaccgcccggacctctcgaagaaggtgctcgacgagatggaactcacacgcaagtgg
gtgctcaagatcgtcggcgacgaatggccgctgcagcaccgtcatgtgcttggccaggcg
attcgcatccgctccccgtacgtcgacgcactgtccgtcacgcaggtgctcgcattgcgt
tcgctgcgtaagaaggtcgacaaggaggagctctccgaaagccagcaggcaggattcatc
tacctgatcctctgcaccgtttcgggtgtcgccgccggcctgcagaacaccggctga

DBGET integrated database retrieval system