KEGG   Bifidobacterium animalis subsp. lactis ATCC 27673: BLAC_07090Help
Entry
BLAC_07090        CDS       T02862                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
banl  Bifidobacterium animalis subsp. lactis ATCC 27673
Brite
Enzymes [BR:banl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BLAC_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1671302..1673902)
Genome map
AA seq 866 aa AA seqDB search
MIGHTTTAYADQSVNTSTETDSYPNGIKGEYNPLGINAGVGISTNDITGEAEKTVLKNFN
QFTVENDLKPEYWYDSNHNFRMSDNAKKMLTFASKNHLVVYGHVLAWYSQTPDWFFQADE
NCQDTDGSPDNGSTTCPLASKEVLLQRQQTFIKNVAEAISNYVGPFGSSTNPVKAYDVVN
ESISDSESPETNGMRNSLWYQITGEEYIDDSFTWANEYMNNTYAEKGSSHPVKLFINDYG
DDGAAKRSRYVALIQRMVDRKVPFDGIGHQTHVSLSTNTDDIKAAIDAMRKFGKKQAITE
LDVGTGTPVTPQKLVEQGRFYYRVNQIIHEEKDQLFSVTVWDLTDATSWRASDGSPCLFN
ADLSIKPAYIGYIGDEGNLPADIKSTTAFKADTNLDSALPSDKTTPGSGSPWDRLPHTSF
AKTTGAVTGEFLPYWNDGKMTVYVSIKDATNTGNDKLVVTTDSGRYDIARSTGKVSTQTG
ASTQVVTARVVNQKDGSGYQAVIQVPISASDMSRSYTDFNIQGVDGTTGTVNGWNAENVM
GNISPLQQTLGYVEAMQLSQKTAAPQVDANPSAAVWSSITPVSLDEVTDGSPLATGTAKV
MWKDDTLYVLVNVVDPYIDTSASSPWEQDSVEVYIDRGNTKSASYSDSTQQIRVSADGLV
SYGSGASTEIQQSLVKTAATRTKNGYAVEMAIDLGKARAGNYEGVDFQINDAKGGSRIGI
RNWANPTGDGYATPAHWGVLRLVESASRDTGGDGSDANSADAGKNTAGRGEAAGNQASKP
SEAAGNQASKPSEAAGNQASKPSEAAGNQASKPSEAAGNQASKPSEPVRVLAKTGVDMTP
LIAAVVVMAALGSALLTLRLRSVHMR
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
gtgattgggcacacaaccacagcttatgctgatcaatctgtaaacacttcaactgagact
gactcatatcccaatggtattaagggtgaatataacccgcttggcatcaacgccggtgtt
ggaatcagtacaaatgacataactggggaagcggaaaaaactgtactaaagaatttcaac
caattcacggtggagaacgatctgaaaccggaatattggtatgattccaatcataatttc
cgcatgtctgacaatgctaaaaagatgctcacattcgcgtctaaaaaccatctggttgtc
tacggacacgtgcttgcatggtacagccagacacctgactggttcttccaagccgacgaa
aattgtcaagacactgatggaagtccagataacgggtccacgacgtgtccgcttgcatcg
aaggaagtgctgctgcagcgacaacaaacatttataaaaaacgttgccgaagcgatctcc
aactatgttggaccgtttggaagctcaacgaatccagttaaagcatatgatgtcgtgaac
gagtctatctccgatagtgaatcaccagagacaaatggcatgcgaaattcattgtggtac
cagattaccggtgaagaatatattgacgattcgttcacgtgggcgaatgaatacatgaat
aatacttatgccgaaaaaggctcaagccatcctgtgaagttattcatcaatgactatggt
gacgatggcgctgcaaaacgaagccgttatgtcgcgttgattcaacgcatggtcgataga
aaagtgccgttcgatggaattggacatcagacccatgtgtcgttgagcacgaacaccgac
gatattaaagctgcgattgatgccatgcgcaaatttggaaagaagcaggccattacggag
cttgatgtgggcaccggcactccagtcacgccgcagaaactagtggaacaaggtagattc
tactatcgtgtgaatcagatcattcacgaagaaaaagaccaattgttctcagtgactgtg
tgggatttgacagatgcaacctcatggcgtgcttcggatggttcgccgtgcctattcaac
gcagacctaagtataaaacccgcctatattggatacattggtgatgaggggaatctgcca
gcagatattaaatcaaccacagcattcaaagcggataccaatctggattccgcccttccc
tctgataagacaacgccaggcagcggttcgccatgggatagattgcctcacacttcattt
gccaaaactacaggagccgtgacgggtgagttccttccatattggaatgatggaaagatg
acagtgtacgtttcgataaaagacgcaacgaacaccgggaatgacaaactcgtggttacc
accgattctggacgatacgacatagctagaagtactggcaaagtaagcacgcagacaggc
gcttccactcaagtggtaacggcacgggttgttaaccagaaggatggtagtggatatcag
gcagtaattcaggttccaatcagcgcaagtgacatgagccgttcatataccgatttcaac
attcaaggtgttgatggtactaccggaacagtgaatggctggaatgccgagaatgttatg
ggcaacatatcaccacttcaacaaactctaggttatgtagaagcaatgcaactatcccaa
aagacggctgcaccacaggttgatgccaatccgtcggcagcggtgtggtcttcgattact
ccggtgagtttagacgaggttaccgatggctcaccgttggccactggcacggcaaaagtc
atgtggaaggatgatacgttgtatgtccttgttaatgtggtggatccgtacattgatacg
agtgcaagttctccgtgggagcaggactccgttgaagtctacattgatcgtggcaacacc
aagagtgcctcatattctgactcaactcagcagatcagggtttcagctgacgggttggtg
tcatatggtagcggtgcctctactgagatccaacaatcattggtcaagacagcggcgaca
agaactaagaacgggtatgcggttgaaatggctatagatcttggcaaggcgcgggcaggc
aattatgaaggagttgattttcagatcaatgatgccaaaggtggtagtcgcatcggaata
cgaaactgggcgaatccaactggtgatggttacgccacccccgcgcattggggcgtccta
agattagttgaatctgcttcgcgtgatactggtggtgatggttcagatgccaacagcgca
gatgctgggaagaatacggcgggtcgcggtgaagctgctggaaaccaagcatcaaaacct
agtgaagctgctggaaaccaagcatcaaaacctagtgaagctgctggaaaccaagcatca
aaacctagtgaagctgctggaaaccaagcatcaaaacctagtgaagctgctggaaaccaa
gcatcaaaacctagtgaaccagtaagagtcctggctaaaacaggtgtcgacatgacacct
ttgattgcggctgttgttgtgatggctgcgctgggcagcgcgttactgacattgagatta
cggtcggttcatatgcgttga

DBGET integrated database retrieval system