KEGG   Bacillus anthracis A16R: A16R_07340Help
Entry
A16R_07340        CDS       T02999                                 

Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
banr  Bacillus anthracis A16R
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:banr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A16R_07340
Enzymes [BR:banr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A16R_07340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
683158..683886
Genome map
AA seq 242 aa AA seqDB search
MVGAVGDDNYGTVVKRNLENERVFIDYVVPVTDAATGIAHIVLAEEDNSIVVVQGANALV
NESVVNRSKDLLIKADMVVLQLEIPLETVKYVLAICQEHKIPVMLNPAPAQVLSEDILEK
ATYITPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDV
VDTTGAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVI
VG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggttggagcagtaggagacgataattatggaactgtagtgaagagaaatttagagaac
gaacgcgtttttatcgactatgtggtaccggttacagatgcggcgacaggaattgctcat
atcgttttagcagaagaggataacagtattgttgtcgtgcaaggggcgaatgctcttgta
aatgagtcggttgtaaatcgttcaaaagatcttcttataaaagctgatatggttgtgctt
caactagagattccgcttgaaacagtaaaatatgtattggctatttgtcaggaacacaaa
atcccggttatgttaaatccagcgccagcacaagtgttatcagaagatattttagaaaag
gcaacttatattacaccaaatgaacatgagtgccgcatcgtattagatgatttcacatcg
ccaattgaagatttactggctaaatatccgaataaactattgatgacagaaggttctaac
ggtgtacgtttccataatggtacggagattgtacatgttcctagcattgctgttgatgta
gtagatacgactggagctggtgatacatttaatggtgcattagcagttgcgctttctgaa
ggagaaacacttcaaaaagcaattcgttttgcgaatattgctggtggtctttctgtaacg
aagcttggggcgcaaggcggtatgccaacgagagatagagtacgtgaagtgcaggtgatt
gtcgggtga

DBGET integrated database retrieval system