KEGG   Bacillus anthracis A16R: A16R_36060Help
Entry
A16R_36060        CDS       T02999                                 

Definition
Glycosidase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
banr  Bacillus anthracis A16R
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A16R_36060
Enzymes [BR:banr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A16R_36060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(3255663..3257015)
Genome map
AA seq 450 aa AA seqDB search
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDRNHWNRLRTDAENL
AQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHK
QNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTL
NNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTA
RKNFAYGTQRDYLDHPDVIGWTREGDSVTC
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaaataacaatagtcggcttgtcggttgttttgtttttacctagtatatat
ggggagagtaaagtgtatgcagatacgattaacaatggaacgttaatgcagtattttgag
tggtatgctccaagtgataggaatcattggaatcgtttgcgcactgatgctgaaaattta
gcgcaaaaaggaattacatctgtttggatacctcctgcgtataaaggaactacgcaaaat
gatgtaggatatggagcatatgatttatatgatttgggtgaattcaatcaaaagggaaca
gtgcggacgaaatatgggacaaaagcacaattgaaatctgcaattgaagctttacataag
caaaacatcgatgtatacggcgatgtagttatgaatcataaaggtggagcagattatact
gaaactgtaacagctgttgaggtagaccgtaacaatcgaaatgttgaggtatcaggtgat
tatgaaattagtgcatggacagggtttaactttcctggacgtggagataattattctaat
ttcaaatggaagtggtatcattttgacggaacggattgggatgaaggaaggaaattaaat
cgaatttataaatttaggggtataggtaaagcatgggactgggaagtgtctagtgagaat
ggaaattatgattatttgatgtatgcagaccttgattttgatcatccagatgttgcgaat
gagatgaaaaattgggggacgtggtatgcgaatgaattaaatttagatggctttcgttta
gatgctgttaaacatattgatcatgaatatttacgcgattgggtaaatcatgttaggcag
caaacggggaaagaaatgtttacggtggctgaatattggcaaaatgatatccaaacttta
aataattatttagcgaaagtcaattataatcaatctgtatttgatgcaccactgcattac
aattttcattatgcttcaaaaggaaatgggaattatgatatgagaaatattttaaatgga
acagtaatgcaaaatcatcctgcactcgcagttactcttgttgagaatcatgattctcag
cctggtcagtcattggaatctgtagtaagtccgtggtttaaaccgttggcatatgcattt
attttaactcgtgcagagggatatccttcagttttttatggtgattactatgggacaagc
ggaaatagtagttatgaaattccagcgttaaaagataaaattgatccgattttgacagca
cgaaaaaactttgcatatggtacgcagcgtgattatttagaccatccagatgtgattgga
tggacgagagaaggtgatagtgtaacatgctaa

DBGET integrated database retrieval system