KEGG   Bacillus anthracis A16R: A16R_42300Help
Entry
A16R_42300        CDS       T02999                                 

Definition
Protein-glutamine gamma-glutamyltransferase
Orthology
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
banr  Bacillus anthracis A16R
Brite
Enzymes [BR:banr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     A16R_42300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
Position
3824504..3825334
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEIYSFRTSDELSFDLNLRVNIITSA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEKETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYALNERRVPYAFISAFLTDTITRIDSR
LMSYHASPSTPQTSIGFIPIRDDAIVATVGNTTTVY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggccgttctattgtacatccttatatcacaaatgaatatgagccattt
gcagctgagaaacaacaaattttatctataatggcaggaaatcaagaaatctattccttt
cgaacatccgatgaactcagctttgatctaaatttgcgcgttaatattattacttctgca
ttagaactttttcaaagtggttttcagtttcgcacatttcaacaatctttttgcaaccct
caatattggaaaagaacgtctcttggaggattcgagctccttccaaacatacccccttcc
attgccatacaagatattttcaaaaacggaaaactatatggaactgaatgtgccaccgct
atgatcattattttttacaaagctttactatcattgtatgagaaagaaactttcaaccgt
ctctttgcaaaccttttactttatacgtgggactacgatcaagatttaaagctcataaca
aagacaggtggcgatcttgtcccaggtgatctcgtttactttaaaaatccacaagtgaat
ccagctacaatcgagtggcaaggagaaaatacaatctatctaggaaatttctttttttat
gggcatggcgtaggtgtaaaaacaaaagaagaaattatatacgcattaaatgagcgacga
gtcccttacgcttttatttctgctttcttaaccgatactattacccgtattgatagccgt
ctcatgagctaccacgcttctcctagtacaccacagacatccataggatttattccgatt
agagatgatgcaatcgttgcaacagttggcaacacaactacagtttattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system