KEGG   Bacillus anthracis A16: A16_03620Help
Entry
A16_03620         CDS       T02998                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bant  Bacillus anthracis A16
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bant00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A16_03620
   00650 Butanoate metabolism
    A16_03620
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A16_03620
   00280 Valine, leucine and isoleucine degradation
    A16_03620
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A16_03620
Enzymes [BR:bant01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A16_03620
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     A16_03620
Amino acid related enzymes [BR:bant01007]
 Aminotransferase (transaminase)
  Class III
   A16_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
331991..333427
Genome map
AA seq 478 aa AA seqDB search
MEKNVGIHFAIKRENNVKKRMGYVMNTKKFAKVNEQIPGPKAASLLERRQNIVPKGVSNG
IPTFVQSANGALVTDVDGNQYIDFAGAIGTINVGHCHPAVKEALHKQVDQYIHTGFNVMM
YEPYIELAEKLAALAPGSFDKQVLFLNSGAEAVENAVKIARKYTKRPGIIAFSKGFHGRT
LMTMTMTSKVKPYKFGFGPFAPEVYKAPFPYEYRCPEGLTEEQYDDFMIEEFKNFFISEV
APETIAAVVMEPVQGEGGFIVPSKKFAQEVRNICSEHGILFVADEIQTGFSRTGKYFAID
HYDVVPDLITVSKSLGAGVPISGVIGRKEIMNESAPGELGGTYAGSPLGCAAALAVLDVI
EKENLNDRAIELGKVVMNRFEEMKNKYNCIGDVRGLGAMCAFELVQDRKTKTPDKTLTAN
LCTEANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEGLTIIEESLQICYEKANTARV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagaatgttggcatacattttgcaataaaaagagaaaacaatgtaaagaaaagg
atggggtacgtaatgaatacaaaaaaatttgctaaagtaaatgaacaaattcctggaccg
aaagcagcgtctttactagaacgccgccaaaatatagtaccaaaaggagtaagtaacggc
atcccaacgtttgtacaatctgcaaacggtgctcttgtaacagatgttgatggcaatcag
tacattgatttcgctggagcgataggaacaattaacgtagggcattgtcacccagctgtt
aaagaagcgctccataaacaagtagatcaatacatccatacgggctttaatgtcatgatg
tatgagccatatattgaattagcagaaaaacttgcggcattagcaccaggaagttttgat
aagcaagtactatttttaaatagtggtgcagaagcagttgagaatgcggtgaaaatcgct
cgtaaatatacaaaaagacctggcattatcgctttttctaaaggtttccacggacgtaca
ttaatgacaatgacgatgacaagtaaagtaaaaccatataaatttggatttggcccattt
gctccagaagtatataaagcgccattcccttatgaatatcgttgcccagaaggattaacg
gaagagcagtatgatgactttatgattgaagagtttaagaatttcttcatatcagaagta
gcaccagaaacgattgcagccgttgtaatggaacctgttcaaggggaaggtggatttatc
gtcccaagtaagaagtttgcgcaagaagtacgcaatatttgttcagaacacggcatctta
tttgtagcggatgaaattcaaacaggatttagccgtacaggaaaatattttgccattgat
cattatgatgtcgttccggatttaattacggtatctaaatcattaggtgctggtgtacca
attagtggtgttattgggcgcaaggaaattatgaatgagtctgcaccaggagagcttggg
ggaacgtatgcgggaagcccgctaggatgtgcggcagcattagcagtacttgatgtaata
gaaaaagagaatttaaatgatagagcgatagaattaggaaaagttgtaatgaaccgattc
gaagagatgaaaaataaatataattgcatcggtgatgtgcgcggtttaggagcaatgtgt
gcattcgagctcgttcaagaccgtaagacgaaaacacctgataaaacgttaacagctaat
ttgtgcacagaagcaaacaaacgcggcctacttctactatcagcaggaacatacggtaat
gttattcgtgtactaatgccgctagttattacagatgagcaactggaagaaggattaaca
attattgaagaatcattgcaaatttgttatgagaaagcaaatactgcccgtgtttaa

DBGET integrated database retrieval system