KEGG   Bacillus anthracis A16: A16_07290Help
Entry
A16_07290         CDS       T02998                                 

Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bant  Bacillus anthracis A16
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bant00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A16_07290
Enzymes [BR:bant01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A16_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
683045..683941
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGDDNYGTVVKRNLENERVFIDYVVPVTDAATGIAHIVLAEEDNSIVVVQGANALVNESV
VNRSKDLLIKADMVVLQLEIPLETVKYVLAICQEHKIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagtatttcaatggacttagtggccgtttcaaaaaaa
cgtccgaaagcaggggaaacagtaattggtgaagcatttcatacaattccaggagggaaa
ggagctaaccaggcggttgctgcagctagattaggcgcaaatgtagcgatggttggagca
gtaggagacgataattatggaactgtagtgaagagaaatttagagaacgaacgcgttttt
atcgactatgtggtaccggttacagatgcggcgacaggaattgctcatatcgttttagca
gaagaggataacagtattgttgtcgtgcaaggggcgaatgctcttgtaaatgagtcggtt
gtaaatcgttcaaaagatcttcttataaaagctgatatggttgtgcttcaactagagatt
ccgcttgaaacagtaaaatatgtattggctatttgtcaggaacacaaaatcccggttatg
ttaaatccagcgccagcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acaccaaatgaacatgagtgccgcatcgtattagatgatttcacatcgccaattgaagat
ttactggctaaatatccgaataaactattgatgacagaaggttctaacggtgtacgtttc
cataatggtacggagattgtacatgttcctagcattgctgttgatgtagtagatacgact
ggagctggtgatacatttaatggtgcattagcagttgcgctttctgaaggagaaacactt
caaaaagcaattcgttttgcgaatattgctggtggtctttctgtaacgaagcttggggcg
caaggcggtatgccaacgagagatagagtacgtgaagtgcaggtgattgtcgggtga

DBGET integrated database retrieval system