KEGG   Bacillus anthracis A16: A16_30270Help
Entry
A16_30270         CDS       T02998                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bant  Bacillus anthracis A16
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bant00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A16_30270
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A16_30270
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A16_30270
Enzymes [BR:bant01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A16_30270
Exosome [BR:bant04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A16_30270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2769997..2771670)
Genome map
AA seq 557 aa AA seqDB search
MSELALKMKRLLLVGTIILSMLCTESLMNYHTAEAKVKKVERKPKNVIIMVMDGTSSTAT
TLARLYKGKPLALDEIVTGGVRTYSAESAITDSAPAATALATGNKSNSGYVGVLPSIVSS
SGLKPMKEEDKLRPVANVLEGAKRTGRATGIVATAEIQHATPAGFSAHHVNRNNFEVLAE
QQVYQNIDVVLGGGKAALLPETDSGIRKDGEDLVKVIKNKGYDFVETKEALLGSKSNKIW
GSFSLNALAFDMDREATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHVNDP
IGMISDVLAFDNAVAEALKFAKKDGNTMLIAVADHGNSGISIGNMNTTKGYNTTPISAYI
YPLKKAKMTLEGTINNLKADISNVEEVAKLYGLDNLTYDEKERLKTAKKKIDVGPIFTTL
LSKRANIGFTTGGHTGEDVFLYSYGPQKPYGLIQNTDVAKTMAKAMGFNLEKVTNKLFVE
SESAIKQNDAAVTIDKTDVANPVLIVKRNNVTAQLFVNKNIIRIKNKEYELGSVVVESNG
KVYVPEEAIHLFRKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagttagctttaaagatgaagagattactgttagtaggaacaatcatactaagt
atgttatgtactgaaagtttgatgaattatcatacagcggaagctaaagtgaaaaaagta
gaacgcaagcctaaaaatgtaatcataatggttatggacggaacaagttctacagcaact
acattagctcgcttgtataaagggaaaccacttgcattagacgaaattgtaacaggagga
gttcgtacatattcggcggaatcagctataacagactcagctccagcagctacagcttta
gcgacggggaataaatcaaattcaggatatgtaggtgtattaccttcaattgtaagttca
tctggcttaaaaccaatgaaagaagaggataagttacgaccagttgccaatgttttagaa
ggtgcaaaacgtacgggtcgcgcaactggaattgttgctacagctgaaattcagcatgct
actcctgctggattctccgctcatcatgtgaatcgtaacaatttcgaagtgctcgcggag
caacaagtatatcaaaatatagatgtcgtattaggtgggggaaaagcagcacttctacct
gagacagatagtgggattcgaaaagacggtgaagatttagtaaaagtgatcaaaaacaaa
ggttacgactttgttgaaacgaaagaagcattattaggctctaaatctaataaaatttgg
ggctctttctcgcttaatgctttagcatttgatatggatcgtgaagcaacaaacccagag
caaccaacactttctcaaatgacggaaaaagcaattcaaacgttatcaaaagataaagat
ggcttctttttatttgtggaaggaagtaagccagactgggcagctcatgtgaatgatcca
attgggatgattagtgatgtattagcatttgataatgcagttgcagaagcattgaagttt
gcaaaaaaagatggtaatacgatgctaatagccgtagcggaccatggtaatagcggtatt
tctattgggaatatgaatacgacaaaaggatataatactacgccgatctctgcgtacatt
tatccattgaaaaaagcgaagatgacacttgaagggactatcaataatttgaaagctgat
atatcaaatgtagaagaggtagctaaattatacgggttggacaatttaacttatgatgaa
aaagaaaggttaaaaacggctaaaaagaaaatagatgtaggtccaattttcactacatta
ttgtctaagcgtgcgaacataggcttcacaacaggagggcatacaggtgaggatgtattc
ttatattcatacggtcctcaaaagccatacggtttgattcaaaatacggacgttgcgaag
acgatggcgaaagcgatgggctttaacttagaaaaagtaacaaacaaattatttgtagaa
agtgaatcagccattaagcagaatgatgcagctgtaacaatagataaaactgatgtagcg
aaccctgtactcatagtaaaacgtaataatgtaacagctcaattatttgttaacaaaaat
ataattcgtattaagaataaagagtatgaattaggaagtgttgttgtagaaagtaatgga
aaggtttacgtaccagaagaagcaattcatctatttagaaaacattctcgttaa

DBGET integrated database retrieval system