KEGG   Bacillus anthracis A16: A16_41770Help
Entry
A16_41770         CDS       T02998                                 

Definition
Protein-glutamine gamma-glutamyltransferase
Orthology
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bant  Bacillus anthracis A16
Brite
Enzymes [BR:bant01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     A16_41770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
Position
3825014..3825844
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEIYSFRTSDELSFDLNLRVNIITSA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEKETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYALNERRVPYAFISAFLTDTITRIDSR
LMSYHASPSTPQTSIGFIPIRDDAIVATVGNTTTVY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggccgttctattgtacatccttatatcacaaatgaatatgagccattt
gcagctgagaaacaacaaattttatctataatggcaggaaatcaagaaatctattccttt
cgaacatccgatgaactcagctttgatctaaatttgcgcgttaatattattacttctgca
ttagaactttttcaaagtggttttcagtttcgcacatttcaacaatctttttgcaaccct
caatattggaaaagaacgtctcttggaggattcgagctccttccaaacatacccccttcc
attgccatacaagatattttcaaaaacggaaaactatatggaactgaatgtgccaccgct
atgatcattattttttacaaagctttactatcattgtatgagaaagaaactttcaaccgt
ctctttgcaaaccttttactttatacgtgggactacgatcaagatttaaagctcataaca
aagacaggtggcgatcttgtcccaggtgatctcgtttactttaaaaatccacaagtgaat
ccagctacaatcgagtggcaaggagaaaatacaatctatctaggaaatttctttttttat
gggcatggcgtaggtgtaaaaacaaaagaagaaattatatacgcattaaatgagcgacga
gtcccttacgcttttatttctgctttcttaaccgatactattacccgtattgatagccgt
ctcatgagctaccacgcttctcctagtacaccacagacatccataggatttattccgatt
agagatgatgcaatcgttgcaacagttggcaacacaactacagtttattaa

DBGET integrated database retrieval system