KEGG   Bacillus anthracis A16: A16_48220Help
Entry
A16_48220         CDS       T02998                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bant  Bacillus anthracis A16
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bant00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    A16_48220
Enzymes [BR:bant01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     A16_48220
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     A16_48220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4392142..4392756)
Genome map
AA seq 204 aa AA seqDB search
MPELPEVENVRRTLENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGETIENIKRRGK
FLLLYVTNYVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLF
KKGEEMNQMPLADLGPEPFDAELTPQYLHERLQKTNRKIKVVLLDQRLLVGLGNIYVDEV
LFRSQIHPEREASSLTAEEIERIL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaacgtcagacggacacttgaaaatcttgtaacagga
aaaacaattgaagacgtcattgttacctatcccaaaatagtaaaacgcccagatgatgca
gaaatctttaaagaaatgctaaaaggcgagacgattgaaaatataaagcgaagaggaaag
tttttgcttttatatgtaacgaattatgttattgtttcacatttgcgtatggaaggtaag
tttttactgcatcaagaggatgaaccaattgataagcatacgcacgtccgtttcttgttt
acagatggaactgaattacattataaagatgtgagaaagttcggtacgatgcatctcttt
aaaaaaggtgaggaaatgaatcaaatgcctctagctgacttaggtccagagccatttgat
gctgaattgacaccacagtatttacatgagagattgcaaaagacaaatcggaaaataaaa
gttgtattgttagaccagcgtcttttagtaggacttggaaatatatatgtagatgaagtt
ttattccgttctcaaattcacccagaacgagaagcgtcttctttaacagcggaagaaatt
gagcggattttatga

DBGET integrated database retrieval system