KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_0170Help
Entry
BAMF_0170         CDS       T01321                                 

Gene name
ybbD
Definition
beta-hexosaminidase, lipoprotein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAMF_0170 (ybbD)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BAMF_0170 (ybbD)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BAMF_0170 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(192093..194003)
Genome map
AA seq 636 aa AA seqDB search
MKLVISAVLLLFIVSGTHHASTKPDIPSQAEQAVSRMTLDEKLGQMLMPDFRNWQKKGQS
SPQALTQMNDEVAGLIQKYRFGGVILFEENVKSTEQTVRLTDAFQKASPDIPLLLSIDQE
GGIVTRLGEGTHFPGNMALGAARKTAYASQTGAIIGKELKALGINTNFAPVLDINNNPGN
PVIGVRSFSSDRDLTASLGLASMKAQQKQDVAAAVKHFPGHGDTDVDSHYGLPLVTHSQE
RLRQIELYPFRKAIQAGADMIMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKVMTHLL
REEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPAQVTSLQTENRFAQVL
AALKKAVQKGEIPVQQINKSAERIISLKIKRGIYPAKETSLNKKVAKAKQTVGSKNHLKA
EKQIAERSVTVLQNKNRTLPFKPKKNSRVLIAAPYEDQTASMEQTIRQLIKKKEIRPVTI
SKMNFAERTFNDEYKKLVSDADYVITGSYVVKNDPVVNDGTIDDSVTDPGKWTTAFPRAV
MKSAQSNHKPFVLMSLRNPYDAANFEEAEALIAVYGFKGYADGQFLQPNIPAGIEAIFGQ
TKPKGRLPVDIPSVTHPGTTLYPYGFGINLKNGKPL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtcatctcagctgtattactgttgttcattgtttccggcacacatcatgca
tcgacaaaaccggacattccgtcacaggcggaacaagcggtatcccgcatgacattagat
gaaaaactggggcagatgctcatgcctgattttcgaaattggcaaaagaaggggcagtca
tcccctcaggctcttacccaaatgaatgacgaagtcgcagggcttattcaaaagtaccgg
ttcggcggcgttatcttatttgaagaaaatgtaaaaagcactgagcaaacggtccgcctg
acagatgcctttcaaaaggcgagccctgatattccacttttattaagcattgatcaagaa
ggcggcatcgtaacaagacttggtgaaggcactcatttcccaggcaatatggcactcgga
gccgcgagaaaaacagcttacgcgtcccagaccggcgccataatcgggaaagaactgaag
gcacttggcattaatacgaatttcgctcccgttctcgatatcaataataatcccggaaat
ccggtcatcggcgtcaggtcattcagttcagaccgtgatctgacagcatcactcggcctt
gcctcaatgaaggctcagcaaaaacaggatgtcgctgccgccgtcaaacatttcccggga
cacggcgatacggatgtcgacagccactacggcctcccgcttgtcacccacagtcaagaa
aggctgcgtcagattgaactttatccgttccggaaagccattcaggccggggccgatatg
atcatgacagcccatgtgcaatttcccgcttttgacgatacaacttataaaagcaaactg
gacggttcagacatcctcgtacccgccacactctcgaaaaaagtgatgactcatcttctc
cgtgaggaaatgggatttaacggcgtcattgtcacggatgcattaaatatgaaagccatt
gccgatcatttcggccaggaagaggcggtcgtcatggccgtaaaagcaggagtggatatc
gctctgatgccggcccaagtgacatcgctgcaaacggaaaaccgctttgcccaagttctt
gccgctttaaaaaaggcggttcagaaaggggaaataccggttcagcaaattaacaaatcg
gcggaacgcatcatttccctgaaaataaaaagaggtatatatcccgcgaaagaaacaagt
ctgaataagaaggtcgcaaaagcaaagcaaaccgtcggaagcaaaaaccatctgaaagct
gaaaaacaaatcgcggaaagatccgtcaccgtcttacaaaacaaaaaccgtacccttcca
ttcaaaccgaaaaagaacagccgcgttctcattgccgctccttatgaagatcaaacagca
tccatggaacaaaccatccggcagctcatcaagaagaaagagatccggccggtaaccatc
agtaaaatgaacttcgccgagcgcacatttaatgatgagtataaaaagctcgtatccgac
gccgattacgtcattacaggctcatatgtcgtgaaaaatgaccctgtcgtaaatgacggc
accattgacgattctgtcacagatcccggcaagtggacgaccgcatttccgcgggccgtc
atgaaatccgcacaatcgaaccataaaccctttgtgctgatgagccttcgtaatccttac
gacgccgctaattttgaagaagctgaagcccttattgcagtctacggctttaaaggatat
gcagacggacaatttcttcagccaaacattccggcaggcattgaagcgatattcggacag
acaaaaccgaaaggcaggctgcccgttgacattccttccgtcactcacccgggaacgacg
ctgtacccttatggcttcggaattaatctaaaaaacggaaaaccgctttaa

DBGET integrated database retrieval system