KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_0298Help
Entry
BAMF_0298         CDS       T01321                                 

Gene name
nasF
Definition
uroporphyrin-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bao00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(319781..321220)
Genome map
AA seq 479 aa AA seqDB search
MKNGIVYFVGAGPGDPGLITVKGKQALEKAEIILYDRLANPKFLEYASPECRFIYCGKLP
DRHFMKQSEINALLIEKAAEGFTVVRLKGGDPSVFGRVGEEAEALHQHGIRYEMVPGITS
GIAAPMYAGVPVTHRDFASSFAMITAHDKSLQGRPNLDWEGLARSVQTLVFYMGVKNLSF
ICRKLMEYGKSPSVPVLVIQWGTWGRQRSIKGTLHDIHEKVQSRKITNPAIIVIGDIVNF
QTHSWFESKPFIGRHIMVVTHGDAEHTLTDKLREYGADVIEWPKRIIKKMPVNETILKQI
GTFEHIFFTSRLAVCEFFDTLAFNQIDIRRVTANLNAATEAAQKELEKRGFLLSEYQSDS
PHSLIVGSRQAAVNMPDSESCPFYVTHEHIADERFTSMIERTISESPLQMIICPDKEAAQ
HLISAGKEIGISPNPSANRPPVVCMGEDVPAGYGFTAVKNQEQLFAFIRNEMKEVLLHS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacggaatcgtatattttgtcggtgcaggacccggagacccggggctgatcacc
gtaaaaggaaaacaggctctggagaaagcggagatcattttgtatgaccggctcgcaaac
ccaaagtttcttgaatatgcctcaccggaatgccggttcatctattgcggaaagctgccc
gaccgccattttatgaaacagtcggagatcaatgccctgctgattgaaaaagcggcggag
ggcttcaccgtagtccgcttgaaaggcggagatccaagtgtgttcggcagagtcggcgaa
gaagcagaggcgcttcatcagcacggcatccgctacgaaatggtgcccggcatcacctcg
ggaatcgcagcgccgatgtatgcgggagtccctgtcacccatcgtgatttcgcttcgtcc
ttcgccatgattaccgctcatgataaatcattacaaggcaggccgaatcttgactgggaa
gggcttgccagaagcgttcaaacgcttgtgttttacatgggcgttaaaaatctgtcattt
atatgccggaagcttatggagtacggaaaatccccttccgtccctgtactcgtcattcaa
tggggaacatgggggcggcagcggagcataaaaggaacgcttcacgatatccatgaaaaa
gtacaaagccgtaaaatcaccaaccctgccattattgtcatcggagatatcgtgaatttt
caaacacatagctggtttgaaagcaaaccgttcatcggccggcatatcatggtggtcacc
catggcgatgctgaacatacattgacagacaagctgcgggagtatggcgccgatgttatc
gaatggccgaagcggatcattaaaaaaatgccggtcaacgaaaccatcctaaaacagatc
ggcacctttgaacatatctttttcacatcacgccttgccgtctgtgaattctttgacaca
ttggctttcaaccaaatcgacatccgccgggtgaccgcaaacctgaatgcagcgactgaa
gcggcacagaaggaacttgaaaaacggggcttcctcctatcagaatatcaaagtgattct
ccgcattcactcattgtagggagccgtcaagcggcagtaaacatgccagactcagaatca
tgcccgttttatgtcacccatgaacatattgcagatgagcggttcacttccatgatcgaa
cgcacgatcagtgagtcccctctgcaaatgattatctgtccggacaaagaagccgctcag
catttgatcagcgcgggaaaagagatcggcatatcaccgaacccgtcggcaaaccgccct
cctgtcgtctgcatgggcgaagacgtgcccgccggttacggatttaccgccgtgaaaaat
caggaacaattatttgcgtttatacgaaatgaaatgaaagaagtgctccttcacagctga

DBGET integrated database retrieval system