KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1119Help
Entry
BAMF_1119         CDS       T01321                                 

Gene name
aprE
Definition
extracellular alkaline serine protease (EC:3.4.21.-)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
Enzymes [BR:bao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BAMF_1119 (aprE)
Peptidases [BR:bao01002]
 Serine Peptidases
  Family S8: subtilisin family
   BAMF_1119 (aprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1145220..1146368)
Genome map
AA seq 382 aa AA seqDB search
MRGKKVWISLLFALALIFTMAFGSTSSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVI
SEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAYAQSVPYGVSQIKA
PALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVA
ALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSA
ALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVG
PELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENT
TTKLGDSFYYGKGLINVQAAAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggcaaaaaagtatggatcagtttgctgtttgctttagcgttaatctttacgatg
gcgttcggcagcacatcctctgcccaggcggcagggaaatcaaacggggaaaagaaatat
attgtcgggtttaaacagacaatgagcacgatgagcgccgctaagaagaaagatgtcatt
tctgaaaaaggcgggaaagtgcaaaagcaattcaaatatgtagacgcagcttcagctaca
ttaaacgaaaaagctgtaaaagaattgaaaaaagacccgagcgtcgcttacgttgaagaa
gatcacgtagcacatgcgtacgcgcagtccgtgccttacggcgtatcacaaattaaagcc
cctgctctgcactctcaaggctacactggatcaaatgttaaagtagcggttatcgacagc
ggtatcgattcttctcatcctgatttaaaggtagcaggcggagccagcatggttccttct
gaaacaaatcctttccaagacaacaactctcacggaactcacgttgccggcacagttgcg
gctcttaataactcaatcggtgtattaggcgttgcgccaagcgcatcactttacgctgta
aaagttctcggtgctgacggttccggccaatacagctggatcattaacggaatcgagtgg
gcgatcgcaaacaatatggacgttattaacatgagcctcggcggaccttctggttctgct
gctttaaaagcggcagttgataaagccgttgcatccggcgtcgtagtcgttgcggcagcc
ggtaacgaaggcacttccggcagctcaagcacagtgggctaccctggtaaatacccttct
gtcattgcagtaggcgctgttgacagcagcaaccaaagagcatctttctcaagcgtagga
cctgagcttgatgtcatggcacctggcgtatctatccaaagcacgcttcctggaaacaaa
tacggggcgtacaacggtacgtcaatggcatctccgcacgttgccggagcggctgctttg
attctttctaagcacccgaactggacaaacactcaagtccgcagcagtttagaaaacacc
actacaaaacttggtgattctttctactatggaaaagggctgatcaacgtacaggcggca
gctcagtaa

DBGET integrated database retrieval system