KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1396Help
Entry
BAMF_1396         CDS       T01321                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAMF_1396 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAMF_1396 (proB)
Enzymes [BR:bao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BAMF_1396 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1396739..1397851
Genome map
AA seq 370 aa AA seqDB search
MKKQRIVVKIGSSSLTNSNGSIDEAKIKEHTEAISLLKENGHEVILITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQTLLMQQYMDHLKRYGLTPAQILLTRNDFSKRERYRNAYATV
MELLERGVVPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPDAKRFDYLTDITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGAGREK
LKLILDGKGDGTYIGDKELSSVNNTRQWIMFHSPISGEIIIDGGAEQAMIHNGSSLLPAG
VADVCGSFPKGAVVEVRGPGGIIGKGQTHYSSDEILEAKGKRSDQLPGAKQVEVIHRNDW
VNLFDEGENK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcagagaattgttgtgaaaatcgggagcagctcgctcacaaacagtaacgga
agtattgatgaagccaaaatcaaggagcatacggaagccatttcattattaaaagaaaac
gggcatgaagtaatccttattacctcaggcgcggtggcagcgggtttttccgctctcggc
tatccgtcgcgccccgttacaataaaaggaaagcaggcagccgccgcggtcggccagacg
cttttaatgcagcaatatatggaccatttaaaaagatacggtctgacgccggcgcaaatt
ttattaacaagaaatgatttctcaaaaagagagcggtacagaaatgcgtatgccacggta
atggaattgctggagcggggagtcgtgccgattattaatgagaatgattccacatcagtc
gaagagctgacgttcggagataatgacatgctgtcggcgcttgtgagcggcctgattcat
gcagaccaattaatgattctcacagacattaacggcctgtacgatgccaatccgaatgaa
aatcctgacgcaaagcggtttgattatttgactgacattacacctgaattgctcgggtat
gccggttcagcaggctcgaaagtcggcaccggaggcatgaagtcaaaacttctcgctgcc
cagaccgcgttgtcgctcggagttaaggtgtttatcgggaccggtgccggacgggaaaaa
ctgaagctgattttagatggtaaaggcgacggtacatatatcggtgataaagagctgtcc
tccgttaataatacacggcaatggatcatgtttcattctccgatatcaggggaaatcatc
attgatgggggagcggagcaggcgatgatccataacggctcaagtctccttccggccggt
gtcgccgatgtctgcggcagttttccgaaaggggccgtagtggaagtcagaggtcccggc
ggcatcatcggcaaagggcagacgcattactcatccgatgagattttggaagccaaaggg
aagcggagcgatcagcttccgggcgcgaagcaggtggaagtgattcacagaaatgattgg
gtgaatttatttgacgagggggaaaacaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system