KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1535Help
Entry
BAMF_1535         CDS       T01321                                 

Gene name
pdhC
Definition
pyruvate dehydrogenase (dihydrolipoamide acetyltransferase E2 subunit) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bao01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bao00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bao00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bao00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535993..1537321
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVEEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSDESGDAKTEAQVQSSAEAGQDVAKEERAAEP
AKETGAGQQDQAEADPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAAQEAAPQKTAAPQETAKPAAAQAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQ
KHYFNIGIAADTEKGLLVPVVKNADRKAVFEISDEINSLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccggatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgttaagccaaacgacgaggtagaagaagacgatgtactggctgaagtgcaa
aatgataaagcagtggtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgattattacgtttgacgcacctggt
tacgaagatcttcaatttaaaggaagcgacgaatccggcgatgcgaaaactgaagcgcaa
gttcagtcttcagctgaagcaggacaggacgtagcgaaagaagaacgcgcagcagagcct
gcaaaagaaaccggcgcaggacagcaggaccaagcggaagctgatccgaacaaacgcgtg
atcgctatgccttccgtacgcaaatatgcccgtgaaaaaggcgttgatatccgcaaagtt
acaggttcaggaaataacggacgtgttgtaaaagaagatatcgacagctttgtaaacgga
ggagcggctcaagaagcggcaccgcaaaaaacagcagcacctcaggaaacagctaaacct
gcagcagctcaagctcctgaaggcgaattccctgaaacacgcgaaaaaatgagcggtatc
cgtaaagcgattgctaaagcaatggtgaactctaagcatactgcaccgcacgtaactctt
atggatgaagttgacgtaacaaatcttgttgctcaccgcaaacagttcaaacaagttgct
gctgatcaaggcatcaagctgacttacctgccttacgtcgtaaaagcattaacatctgct
ctgaaaaaattccctgttttaaacacatctattgatgataaaacagatgaagtgatccaa
aaacattatttcaacatcggaattgcagcggatactgaaaaaggcttgcttgtgccagta
gtgaaaaatgccgaccgtaaagccgttttcgaaatctctgatgaaatcaacagccttgct
acaaaagcgcgtgaaggcaagcttgcacctgcggaaatgaaaggcgcttcttgcacaatc
acaaatatcggttctgccggaggccaatggttcacaccggttatcaaccacccagaggtt
gcgattctcggtatcggccgcatcgctgaaaaagcgatcgtccgcgacggtgaaattgta
gctgctcctgtcttagctctttctctcagctttgaccaccgtatgattgacggagcaact
gcacaaaatgcgttaaaccacatcaagcgtttactgaacgatccacaacttattttaatg
gaggcgtaa

DBGET integrated database retrieval system