KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1535Help
Entry
BAMF_1535         CDS       T01321                                 

Gene name
pdhC
Definition
pyruvate dehydrogenase (dihydrolipoamide acetyltransferase E2 subunit) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAMF_1535 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_1535 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BAMF_1535 (pdhC)
   00620 Pyruvate metabolism
    BAMF_1535 (pdhC)
Enzymes [BR:bao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAMF_1535 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535993..1537321
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVEEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSDESGDAKTEAQVQSSAEAGQDVAKEERAAEP
AKETGAGQQDQAEADPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAAQEAAPQKTAAPQETAKPAAAQAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQ
KHYFNIGIAADTEKGLLVPVVKNADRKAVFEISDEINSLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccggatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgttaagccaaacgacgaggtagaagaagacgatgtactggctgaagtgcaa
aatgataaagcagtggtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgattattacgtttgacgcacctggt
tacgaagatcttcaatttaaaggaagcgacgaatccggcgatgcgaaaactgaagcgcaa
gttcagtcttcagctgaagcaggacaggacgtagcgaaagaagaacgcgcagcagagcct
gcaaaagaaaccggcgcaggacagcaggaccaagcggaagctgatccgaacaaacgcgtg
atcgctatgccttccgtacgcaaatatgcccgtgaaaaaggcgttgatatccgcaaagtt
acaggttcaggaaataacggacgtgttgtaaaagaagatatcgacagctttgtaaacgga
ggagcggctcaagaagcggcaccgcaaaaaacagcagcacctcaggaaacagctaaacct
gcagcagctcaagctcctgaaggcgaattccctgaaacacgcgaaaaaatgagcggtatc
cgtaaagcgattgctaaagcaatggtgaactctaagcatactgcaccgcacgtaactctt
atggatgaagttgacgtaacaaatcttgttgctcaccgcaaacagttcaaacaagttgct
gctgatcaaggcatcaagctgacttacctgccttacgtcgtaaaagcattaacatctgct
ctgaaaaaattccctgttttaaacacatctattgatgataaaacagatgaagtgatccaa
aaacattatttcaacatcggaattgcagcggatactgaaaaaggcttgcttgtgccagta
gtgaaaaatgccgaccgtaaagccgttttcgaaatctctgatgaaatcaacagccttgct
acaaaagcgcgtgaaggcaagcttgcacctgcggaaatgaaaggcgcttcttgcacaatc
acaaatatcggttctgccggaggccaatggttcacaccggttatcaaccacccagaggtt
gcgattctcggtatcggccgcatcgctgaaaaagcgatcgtccgcgacggtgaaattgta
gctgctcctgtcttagctctttctctcagctttgaccaccgtatgattgacggagcaact
gcacaaaatgcgttaaaccacatcaagcgtttactgaacgatccacaacttattttaatg
gaggcgtaa

DBGET integrated database retrieval system