KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1557Help
Entry
BAMF_1557         CDS       T01321                                 

Gene name
glsB
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAMF_1557 (glsB)
   00330 Arginine and proline metabolism
    BAMF_1557 (glsB)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BAMF_1557 (glsB)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BAMF_1557 (glsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1553792..1554739
Genome map
AA seq 315 aa AA seqDB search
MVCRHYQELDAFVQEAKKKTGEGKVADYIPALAESGQDSLSVTIYHAENTCLTAGDADRT
FTLQSISKVLSLALVLMDYGKEKVFSCVGQEPTGDPFNSMIKLETVNPGKPLNPMINAGA
LVVTSLIKGHSPKDRLNYLLGFIRRLANNQEITYCRHVAESEFSSSMINRAMCYYMKQYG
IFKGDVEEVMDLYTKQCAIKMSSLDLAKIGCVFALDGKHPETGEQVIKKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYNFGIGIFGPALDEKGNSIAGVKLLEIM
SEKYRLSYFLKHFLS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccggcattaccaggagctggacgcattcgttcaagaagcgaaaaaaaagacc
ggagaaggcaaagtggcagactatattccggctctggctgaatcagggcaagacagcctt
tcggtcacgatttatcatgcggaaaatacatgtctgacggcaggcgacgccgaccggaca
tttacgctgcagagcatttcgaaggtgctttctctggcgctcgtactgatggattacgga
aaggaaaaggtattcagctgcgtggggcaggagccgaccggcgacccgtttaattctatg
attaagcttgagacagtgaatccgggcaagcctttaaatccgatgattaatgcgggagct
ctcgtcgttacgagtttaattaaggggcattcgccgaaagaccggctgaattatctgctc
ggattcatcagaagacttgcgaataatcaggaaattacatactgcagacatgtcgcagaa
tcggaattcagttcatccatgatcaatcgggcaatgtgttattacatgaagcaatatggc
atttttaaaggcgatgttgaagaggttatggatttgtatacaaaacagtgcgcgattaag
atgagcagtcttgatttagccaaaatcggctgcgtattcgcacttgacggcaagcatccg
gaaaccggggagcaggtcattaaaaaagatgtggcgagaatctgcaagacgtttatggtg
acatgcggcatgtacaatgcgagcggtgaattcgcaatcaaggtcggcattcccgcaaaa
agcggcgtttcgggaggcatcatgggcatttcgccgtataatttcggaatcggtatattt
ggcccggcgcttgatgaaaaaggcaacagcatcgcgggtgtgaagcttttggaaatcatg
tctgagaaatacaggctgagttattttttgaaacattttttatcataa

DBGET integrated database retrieval system