KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1727Help
Entry
BAMF_1727         CDS       T01321                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bao00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1724046..1725197
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRMHEDQFRLVSMTFGKNAEKAIPLIRTFQPKYVAVGDMD
TYRKVKEASFSHECQIGIGEEGLIEAAVMDEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKGHAKQYGVPLLPVDSEHSAIFQALQGEQSKNIERLIITASGGSFRD
KTRQELQSVTIADALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDRSVIAQLGNPDMRVPIQYALTYPDRLPLPETKRLELWEIGSLHFAKAD
FERFRCLQFAFESGKIGGTMPTVLNAANEEAVAAFLAGRISFLSIEDLIEKALNRHSVIQ
DPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatatttgtcttttaggagcaacgggatcaataggggagcagacattggatgta
ttgcgcatgcatgaagaccaattccgtctcgtctcgatgactttcggtaaaaacgccgaa
aaagcaatcccgttgatcagaacgtttcagccgaaatatgtagcagtcggcgacatggat
acatatcgaaaagtgaaagaagcgtctttttctcatgagtgtcaaatcggcatcggagaa
gaaggcctgatcgaagcggcggtcatggatgaagtggatatcgtggtcaacgcgctgctc
ggaagcgtcggtttaatcccgactttgaaagcgattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactcttgtcactgccgggcatatagtgaaaggacacgcaaaacaatac
ggcgtgccccttcttccggtcgacagcgaacattccgctatttttcaggcgctgcaagga
gaacagagcaaaaatatcgagcgtctgatcattacggcatcaggcggcagtttcagggat
aaaacacggcaggagcttcagtctgtaacgattgccgacgcccttaaccacccgaactgg
tcgatgggtgcaaagattacgattgattcggctacaatgatgaataaagggcttgaagtc
attgaagcgcactggctgtttgacattccgtatgaacagattgacgttgttttacataag
gagagcattattcattcgatggttgaatttcacgacagaagcgtcattgcccagctcgga
aatccggacatgagggtgccgattcaatacgcgctgacatacccggaccggctgcctctg
cctgaaacaaaaaggcttgaattatgggagatcggaagccttcattttgcgaaagctgac
tttgaaaggttccgctgcttacaatttgcctttgaatcaggtaaaatagggggaacgatg
ccgacggttttaaatgcagccaatgaagaagccgtcgccgcttttcttgccggacggatt
tcgttcttatcgattgaggatctgattgaaaaagcattgaaccgccacagcgtaattcag
gatccgagtcttgcggatatccaagaagtggacaaagacacccggggatacgttaattca
atactcacataa

DBGET integrated database retrieval system