KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1830Help
Entry
BAMF_1830         CDS       T01321                                 

Gene name
xynA
Definition
protein XynA (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
Enzymes [BR:bao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BAMF_1830 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1894601..1895347
Genome map
AA seq 248 aa AA seqDB search
MTVRPEYNLIKREECQMKQKRMKFLLAVLFSLALTLPAWSAQAATTITSNQTGTQDGYDY
ELWKDSGNTSMTLNSGGAFSAQWSNIGNALFRKGKKFDSTKTHSQLGNISINYNATFNPG
GNSYLCVYGWTKDPLTEYYIVDNWGTYRPTGTPKGTFTVDGGTYDIYETTRINQPSIIGI
ATFKQYWSVRQTKRTSGTVSVSEHFKKWESLGMPMGKMYETALTVEGYQSNGSANVTANV
LTISGKSF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaagacctgaatacaatctgatcaaacgggaggaatgccaaatgaaacaaaaa
agaatgaagtttttattagcagttttatttagtctggcgctgacattacctgcatggtcc
gcacaggcggcaactacaatcacctcaaatcagactggcacacaagatggctatgactat
gaattgtggaaggactctgggaataccagtatgacgcttaatagcggcggtgcgttcagt
gcccagtggagtaacattgggaatgctttattccgaaaaggcaagaaattcgattcaacg
aagactcactcacaacttggaaacatatcaatcaattacaacgcaaccttcaatcccggg
gggaattcctatctgtgtgtttatggatggacgaaagatccgctcacagaatattatatc
gtcgataattggggcacctacagaccgactggaacgccgaagggaacttttactgttgac
gggggcacatatgacatttatgaaaccactcgaatcaaccaaccttccattataggtatc
gccacctttaaacagtattggagtgtccggcagacaaaacgaacgagcggaaccgtatct
gtcagcgaacatttcaagaagtgggaaagcttagggatgccaatgggtaagatgtatgaa
accgcgcttacggtagaaggatatcaaagcaatggcagtgctaatgtaactgcaaatgta
ctgactattagcggaaaatccttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system