KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1830Help
Entry
BAMF_1830         CDS       T01321                                 

Gene name
xynA
Definition
protein XynA (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1894601..1895347
Genome map
AA seq 248 aa AA seqDB search
MTVRPEYNLIKREECQMKQKRMKFLLAVLFSLALTLPAWSAQAATTITSNQTGTQDGYDY
ELWKDSGNTSMTLNSGGAFSAQWSNIGNALFRKGKKFDSTKTHSQLGNISINYNATFNPG
GNSYLCVYGWTKDPLTEYYIVDNWGTYRPTGTPKGTFTVDGGTYDIYETTRINQPSIIGI
ATFKQYWSVRQTKRTSGTVSVSEHFKKWESLGMPMGKMYETALTVEGYQSNGSANVTANV
LTISGKSF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaagacctgaatacaatctgatcaaacgggaggaatgccaaatgaaacaaaaa
agaatgaagtttttattagcagttttatttagtctggcgctgacattacctgcatggtcc
gcacaggcggcaactacaatcacctcaaatcagactggcacacaagatggctatgactat
gaattgtggaaggactctgggaataccagtatgacgcttaatagcggcggtgcgttcagt
gcccagtggagtaacattgggaatgctttattccgaaaaggcaagaaattcgattcaacg
aagactcactcacaacttggaaacatatcaatcaattacaacgcaaccttcaatcccggg
gggaattcctatctgtgtgtttatggatggacgaaagatccgctcacagaatattatatc
gtcgataattggggcacctacagaccgactggaacgccgaagggaacttttactgttgac
gggggcacatatgacatttatgaaaccactcgaatcaaccaaccttccattataggtatc
gccacctttaaacagtattggagtgtccggcagacaaaacgaacgagcggaaccgtatct
gtcagcgaacatttcaagaagtgggaaagcttagggatgccaatgggtaagatgtatgaa
accgcgcttacggtagaaggatatcaaagcaatggcagtgctaatgtaactgcaaatgta
ctgactattagcggaaaatccttttag

DBGET integrated database retrieval system