KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1848Help
Entry
BAMF_1848         CDS       T01321                                 

Gene name
RBAM017440
Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAMF_1848 (RBAM017440)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_1848 (RBAM017440)
  Lipid metabolism
   00071 Fatty acid degradation
    BAMF_1848 (RBAM017440)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAMF_1848 (RBAM017440)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAMF_1848 (RBAM017440)
   00626 Naphthalene degradation
    BAMF_1848 (RBAM017440)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAMF_1848 (RBAM017440)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1917508..1918524)
Genome map
AA seq 338 aa AA seqDB search
MKAVIATKDKNIAIVQKELRPLRHGEAKVKMEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGIVTEIGEGVSSLKKGDRVSIAWMFESCGRCEYCLTGRETLCRDVKNAGYTVDGAMAEE
AIVAVDYAVKVPEHLDPAAASSITCAGVTTYKAVKVSEIKPGQWIGVFGVGGLGNLAVQY
AKNVFNAKVIAFDISDEKLNFAKSLGADAVVNSLNEDPVEKAKEVTSDLGLDAAVITAVS
KTPFNQAIDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIQVVGSLVGTREDLKEAFRFAA
DGKVVPKVTKRPIEDVNDIFEEMEQGKVTGRMVIDFTC
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccgtaatagcgacgaaagacaaaaatatagcgatcgtacaaaaagaattacgt
cctttgcgacatggtgaagccaaagttaagatggaatactgcggtgtatgtcatactgac
ttgcatgttaaaaatgctgatttcggggatgtgacaggcgtcactttaggtcatgaagga
ataggcattgtaaccgagattggtgaaggcgtatcaagcctgaaaaaaggagaccgcgtc
tctattgcgtggatgtttgaaagctgcggccgctgtgaatattgcttaacaggccgtgaa
accctgtgccgtgatgtaaaaaatgccggctatacagttgatggcgcgatggctgaagaa
gcaatcgtagcggttgattatgcagtgaaagtgcctgaacatttagatccggcagcagca
agcagcattacttgtgcaggcgtaacaacttataaagcagtaaaagtcagtgaaattaag
cctggtcaatggatcggtgtatttggagtcggcggtttgggcaacttggctgttcaatat
gcaaagaatgtctttaacgctaaagtgattgctttcgacattagcgatgaaaagttgaat
tttgctaagagcttaggtgctgacgcggttgtaaacagtttaaacgaagaccctgtcgag
aaggctaaagaagtgaccagcgatttaggacttgatgctgcggtcattaccgctgtctct
aaaacccctttcaatcaagcgattgatgttgtaaaagcaggagcgcgagtagttgctgtc
ggtttaccggtagataagatggacttagatattccccgtcttgtgttagatggaattcag
gtagtaggttcattagtaggtaccagagaagacctgaaggaagctttccgattcgctgca
gacggtaaagttgtacctaaagtgacaaagcgcccgatcgaagacgtgaatgatatattt
gaagaaatggagcaaggtaaagtgaccggccgtatggttatagattttacttgttaa

DBGET integrated database retrieval system