KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1916Help
Entry
BAMF_1916         CDS       T01321                                 

Gene name
yxjF
Definition
dehydrogenase (EC:1.1.1.-)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BAMF_1916 (yxjF)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BAMF_1916 (yxjF)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BAMF_1916 (yxjF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2006677..2007462)
Genome map
AA seq 261 aa AA seqDB search
MDPLLKDKAAVVTGAARGIGFEIAQEFTREGAAVIIADVNEQAGKEAAAKLSEEGAHAKS
ITCDVTDEKQTADMIQKAVTEFGRLDILVNNAGIQHIAPIEAFPAEQFERLIRVMLTAPF
IAMKHAFPVMKKQQFGRIINMASVNGLIGFYGKAAYNSAKHGVIGLTKVGALEGAADGIT
VNALCPGYVDTQLVHNQLKDISDTRNVPYERVLEDVIFPLVPQKRLLSVKEIADYAVFLA
SDKAKGVNGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggacccattgctgaaagacaaagcggctgtagtgacaggagcagccagaggaatcgga
tttgaaatcgctcaagaattcacccgtgaaggagccgccgtaatcatagcggatgtcaat
gaacaggcgggaaaagaagccgcagcaaaactcagtgaagaaggcgctcatgccaaaagc
atcacgtgtgatgtaaccgatgaaaagcaaacggctgatatgattcaaaaagccgtgaca
gaattcgggcgactcgatattctcgtgaataacgcgggcattcagcatatcgcccccatt
gaggcatttcccgcggaacaatttgaacggctcatccgtgtcatgctgaccgcgccattt
atcgccatgaaacatgcatttcccgtcatgaaaaaacagcaattcggacgaatcataaat
atggcgtctgtcaacgggctcatcggtttttacggaaaagccgcatataacagcgccaag
catggcgtcatcggcttaacgaaagtcggcgcacttgaaggcgcggctgacggcatcacc
gtcaatgccctctgtcctgggtatgttgacacacagctcgtccacaatcagctgaaggac
atttctgacacaagaaatgtgccgtatgaacgtgttctggaggacgtcatctttccgctc
gttccccaaaaacggctgctctcagtgaaggaaatcgctgattacgccgtgtttttggcc
agcgacaaagcaaaaggcgtcaacggtcaggccgtcgtcatggacggaggatataccgct
caatag

DBGET integrated database retrieval system