KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1926Help
Entry
BAMF_1926         CDS       T01321                                 

Gene name
yngB
Definition
UTP-sugar-phosphate uridylyltransferase (EC:2.7.7.-)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAMF_1926 (yngB)
   00052 Galactose metabolism
    BAMF_1926 (yngB)
   00500 Starch and sucrose metabolism
    BAMF_1926 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    BAMF_1926 (yngB)
Enzymes [BR:bao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAMF_1926 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2015903..2016796
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGR
NKRSIEDHFDRLAELEFNLQEKGKTEMLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSDTPALSQLIDVYNQHGTETIGVQPVEPADVSKYGIIQTGRQS
GHVYQVEDLIEKPAAEKAPSRIAVMGRYILTPAIFQALKTIGRGAGSEIQLTDALRKVCR
TRSIYARELEGSRFDIGDKLGCFKAGTEIGLLRKEMRPKLLAYLEEVLKRESEEMTH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggtcatccccgcagcgggtttaggcacgagatttctg
ccggcgacaaaggcgcagccgaaagaaatgctgccgattgtcgacaaaccggcaatccaa
tatattgtagaagaggccgcagaatcaggaattgaagatatactgattattacggggaga
aacaaacgctcgattgaagatcattttgaccggttggcggaattggaattcaatctgcag
gaaaaaggcaagacggagatgcttaaggaaatgcagcagattgccgatttggccaatatt
cattacatccgccagaaagagccgctcggcttaggacatgcggtattgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggagatgatattatggtatctgacacc
cccgcgctttcgcagctcatagacgtctataaccagcacggcacagaaacaatcggcgta
cagcccgtcgagcctgctgatgtcagcaaatatggtattatacagacggggcggcaaagc
ggtcatgtgtatcaggttgaagacctgattgagaagccggctgctgaaaaggcgccctca
cgtattgccgtgatgggccgatacatattaacccctgccattttccaggcgctcaaaacg
atcggacgaggcgcgggcagcgaaatccaattaactgatgcgctgcgcaaagtgtgccgc
acccggagcatttacgcgcgggaacttgaaggaagccggttcgatataggcgataagctc
gggtgttttaaagccgggacggagatcgggcttctgcggaaagaaatgagaccgaaactt
ttagcttatttagaagaggtgttaaaaagagaatctgaagaaatgacgcattaa

DBGET integrated database retrieval system