KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2008Help
Entry
BAMF_2008         CDS       T01321                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex (dihydrolipoamide transsuccinylase, E2 subunit)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00020  Citrate cycle (TCA cycle)
bao00310  Lysine degradation
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
Module
bao_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bao_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAMF_2008 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BAMF_2008 (odhB)
Enzymes [BR:bao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BAMF_2008 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBI43134
Position
complement(2109375..2110622)
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPAKEQTKEEAKAEPAAQEVSQEAQSEAKS
RTVASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQTKPQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNEVK
LGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEKEIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYLALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgactatgtagaacagggtgagtacttgcttgaacttgagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacctgccccttccgaaagtgctccagccaaagaacaaacgaaagaggaa
gcaaaagctgaaccggctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacggtagcgtctccggctgcacgcaagctggcaagggaaaaaggaattgatctttca
caaattccgacgggggacccgctcggccgcgtgcgcaaacaagacgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagacgaaaccgcaggctcaaaaaacacagcaaagc
tttgacaaacctgttgaagtgcaaaaaatgtcccgccgcagacaaacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgacgacatttaacgaagtggacatgacg
gccgttatgaatttaagaaaacgccgtaaagaccaattccttgagcaaaacgaagtaaaa
ctcggtttcatgtctttctttacaaaagccgtagtggcagctttgaaaaagtacccgctc
ctaaacgctgaaattcaaggtgatgagctgatcgtgaaaaaattctatgacatcggtatc
gccgttgcggctgaagaagggcttgtcgtcccagtcgtacgtgacgctgatcgtctgaca
tttgccggcattgaaaaagagatcggcgaacttgcgaagaaagcgcgaaacaataaatta
acattaggtgagctgcaaggaggttccttcacgatcacaaacggaggtacattcggctcg
cttatgtcaacaccaatcctaaacagccctcaggtcggaatcttaggtatgcacaaaatt
cagctgcgccctgtagcgattgatgcagagcgttctgaaaaccgtccgatgatgtacctt
gcattatcatatgatcacagaatcgtagatggtaaagaagcggtcggattccttgtcaca
attaaaaacctgctggaagatccggaacagctgttattagaaggataa

DBGET integrated database retrieval system