KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2031Help
Entry
BAMF_2031         CDS       T01321                                 

Gene name
RBAM_019350
Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BAMF_2031 (RBAM_019350)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BAMF_2031 (RBAM_019350)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BAMF_2031 (RBAM_019350)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2131903..2133381)
Genome map
AA seq 492 aa AA seqDB search
MFFKKGLYMTLAFLLLSFLLSGSMETEVYATDRKAPDKNKVRVWYSSEKDPASRTWYDGP
KEVKYALDEQTPLTLTKKKASDSTAVYIDPSHRYQSVLGIGSSLEESTISNLSKMSPGKR
KEVLKKLVDPNEGIGMDVMRITIGTSDFTAQEFYTYDDMPEGRKDPKLRHFSIQKDIDLH
ITATIKEALAINPKLKIIASPWSPPAWMKTNKNLKRGKLKDKYISELAVYFRKFIEAYEK
QGIPIYAMTLQNEPLLEIDYPSMYMPPSQQRKLAQALKKEMKKHLIDTKIWIYDHNASGA
WNYIPPILDDKKGNQAADGIAFHDYDGDLSVMSEIGRRYPDKSIHLTERSVWGTEGADRI
AQYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWNIPIYHMTGNFSK
FVDRGAKRIESNYGSKNTVSNVSFLNPDQSIVTVVINQTSAEQKFHVVSEDRQFEAVIPA
KTVATYKWQHKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaaaaaaggtctgtacatgacgctggcttttcttttgctttcttttttatta
tcaggcagcatggaaaccgaagtgtatgcgactgatcggaaagctccggacaaaaacaaa
gtaagggtgtggtacagttcggaaaaagatccggcttcccgtacatggtatgacggtccg
aaagaagtgaaatacgccttagatgaacaaaccccactgactttgacaaaaaagaaggct
tctgactccactgccgtgtatattgatccgtcgcaccgctatcaaagtgtattaggcata
ggatcatctctggaagaatccactatctctaatttatcgaaaatgtcgcccggaaaaaga
aaagaagtgttgaaaaaactggttgatcccaatgaaggcatcggcatggacgtcatgcgc
ataacgatagggacatcagattttacggcccaggaattttatacgtatgacgatatgcct
gaaggccgaaaagatcctaagctcagacatttctcgattcaaaaggatattgatttacac
attacagcaaccatcaaggaagcgctggcgataaatccgaagctgaaaatcattgcctca
ccgtggagcccgcccgcatggatgaaaacgaataaaaatctcaagcgaggaaagctgaaa
gataaatatatcagcgagctggccgtttatttccgcaaatttattgaagcgtacgaaaag
caagggatcccgatttatgcgatgactcttcaaaatgaacctttgctggaaattgactat
ccgagcatgtatatgccgccgtctcagcagcgcaaactggcgcaggccttaaaaaaagaa
atgaagaaacatttaattgacacgaaaatttggatttatgatcacaatgcaagcggggcg
tggaactatattccgccgattttagatgataaaaaaggaaaccaggcggcagacggcatt
gcttttcatgattatgacggagacctttccgtcatgtcggaaatcggaaggcgatatcct
gataaatctattcacttaacggagcggtctgtctgggggacagaaggagcggaccggatc
gcgcagtatttccgcaacggcgcgtccagctacaatgcgtgggtgacgatgctcgacagt
caaattaagacgcatcattggataggcaccccggatccgacgctgtttattcaggacgct
aaaaatcctgaccgctattggaatatcccgatctatcatatgacaggcaacttttcaaaa
tttgtcgaccgcggagcaaaacggatagaaagtaattacggctccaaaaacacagtttcg
aacgtatcgtttcttaatcctgatcaatccattgtaacagtcgtgatcaaccagacatct
gcggagcaaaaattccatgtcgtttcagaggatcggcagttcgaagccgttatcccggct
aaaaccgtcgctacctacaaatggcagcacaaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system