KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2032Help
Entry
BAMF_2032         CDS       T01321                                 

Gene name
bglA
Definition
aryl-6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_2032 (bglA)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BAMF_2032 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2133535..2134977)
Genome map
AA seq 480 aa AA seqDB search
MGTLPKDFLWGGALAAHQFEGGWNKGGKGPSVVDVMTAGAHGVPRKITDTIEEREFYPNH
EAIDFYHRYKEDIALFSELGLKCLRTSIGWSRIFPRGDETEPNEEGLAFYDRVFDELLKN
GIEPVITLSHFEMPLHIAREYGGFRNRKTVGFFVKFAEVCFERYKHKVKYWMTFNEINNK
MDVNNPIFLWTNSGVAVKENENAKEVMYQAGHHELLASALAVSKGKEINPDFRIGAMVSH
VPIYPYSSNPDDVMLAEETMRQRFFFPDVQVRGYYPSYALKEFEREGYQIHFEDGDEEIL
KNGTVDYLGFSYYMSTTVKSDVLNDNTGDVVNGGLPNGVENPYITASDWGWAIDPTGLRY
TLNRLYDRYQIPLFIVENGFGAIDTVEEDGSIHDTARIEYLASHIKALEKAVTYDGVDLM
GYTPWGIIDIVSFTTGEMKKRYGMIYVDRDNEGSGSMKRFKKDSFEWYKKVIETNGSYIF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggaacattgccaaaagactttttatggggaggcgctctagccgcccatcaatttgaa
gggggatggaacaaaggcggcaaagggccgagtgtagtggacgtcatgacggcaggcgcg
catggtgtgccccggaaaataacagatacaattgaagagcgggaattttacccgaatcac
gaagctatagatttttatcatcgttataaagaggacatcgcattattcagcgagctggga
ctaaaatgcttaagaacgtccatcggctggagcagaatttttcctagaggtgatgaaaca
gagcctaacgaggaaggacttgctttttacgaccgggtttttgacgaattgctgaagaat
gggattgaaccggttatcacgttgtcacattttgagatgccgctgcatatcgcaagggaa
tacggcggattcagaaacagaaaaacggtcggattttttgtaaaattcgctgaagtgtgt
tttgaacgatacaaacataaagtgaagtattggatgacgtttaacgaaatcaacaacaag
atggatgtgaataatccgatctttttatggacgaattcaggtgtcgccgtcaaagaaaac
gaaaacgcaaaagaagtcatgtatcaggccggccatcacgaactccttgcaagcgcattg
gctgtttcgaagggaaaagaaatcaaccctgatttccggatcggcgcgatggtgtcacat
gttccgatttatccgtactcttccaacccggatgatgtgatgctggctgaagaaacgatg
agacagcgttttttcttcccggatgtgcaggtgcgcggatattatccaagctatgcgtta
aaagagtttgaaagagaaggctatcagatacactttgaagacggtgatgaagagattttg
aaaaacggcacggtggactatctcggattcagctattacatgtccacaaccgtaaaaagt
gatgtgttaaacgataatacgggggatgtcgtaaacggaggattaccaaacggcgtggaa
aacccctatattacagcgagtgattggggctgggcgattgacccgaccggtttacggtac
acattaaaccgtttatacgaccgctatcagattccgttatttatagtggaaaacggattc
ggcgccattgatacggtagaagaggatggttccattcatgacacagcgagaattgaatat
ttagcgtcacatataaaagctttggaaaaagcagtcacatatgatggagtggatctaatg
ggctatacaccgtggggaattatcgatatcgtatcatttacaaccggagaaatgaaaaaa
cgctacggcatgatttatgttgaccgggataatgaaggcagcgggtcaatgaagcggttt
aagaaagactcatttgaatggtataaaaaagtgattgaaacaaacggctcatatatattc
taa

DBGET integrated database retrieval system