KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2164Help
Entry
BAMF_2164         CDS       T01321                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase (alpha subunit)
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00260  Glycine, serine and threonine metabolism
bao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01130  Biosynthesis of antibiotics
bao01230  Biosynthesis of amino acids
Module
bao_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAMF_2164 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAMF_2164 (trpA)
Enzymes [BR:bao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAMF_2164 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB Ste50p-SAM IGPS
Motif
Other DBs
NCBI-ProteinID: CBI43290
Position
complement(2243912..2244709)
Genome map
AA seq 265 aa AA seqDB search
MFNLHDSEKLFIPFITAGDPLPEISVELAKSLQNAGASALEIGVPYTDPLADGPVIQRAS
KRALENGMNIVKAIELGGKMKKNGVHIPIILFTYYNPVLQLEKECFFALLRENDIDGLLV
PDLPLEESALLQKTCKKENIAYISLVAPTSENRLKIITEQAGGFVYCVSSLGVTGVRSEF
DPSVYSFIRKVKEFSSVPVAVGFGISSRKQVDEMNEISDGVVVGSALVRKVEELKTKLVN
SGTRADALLEFEEYAKTFGQLYSVK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctgcatgactctgaaaaattatttatcccttttattacggcgggcgatccg
cttcctgaaatttctgttgaactggcaaaatctttgcagaatgcaggcgcttcagctctt
gaaatcggcgtcccctacacagatccgctcgcggatggccccgtcatacagcgggcttca
aaacgggctctggaaaacggaatgaatatcgtaaaagccattgaacttggcggcaaaatg
aaaaaaaacggcgttcatattccaattatcctctttacgtattataatcctgtgttacaa
ttagaaaaagaatgctttttcgctttactgcgggaaaacgacatagacggtctgcttgta
ccggatcttccgttagaggaaagcgcccttttgcaaaagacatgcaaaaaggagaacatc
gcttatatctcgctggtcgcgccgacaagtgaaaaccgtttgaaaataattactgaacag
gccggcggctttgtgtattgtgtatcttctttaggagtgacgggcgtacgcagcgaattc
gatccgtctgtatactctttcatccgtaaagtgaaagaattcagctcggttccggttgcg
gtcggttttggcatttcaagccgcaaacaggttgacgagatgaatgaaatatcagatggt
gtcgttgtcggaagcgcgcttgtcagaaaggttgaagagcttaaaacaaagcttgtgaat
tccggcacaagagccgatgcgcttcttgaatttgaggaatacgcaaagacgttcggacaa
ctgtacagtgtaaaatga

DBGET integrated database retrieval system