KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2319Help
Entry
BAMF_2319         CDS       T01321                                 

Gene name
RBAM_022490
Definition
(GenBank) RBAM_022490
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2381021..2381656)
Genome map
AA seq 211 aa AA seqDB search
MAWLLILGLAVSSSIDNLGVGMSYGIRKIKISHASNMMIAFICFLFSYIGIYFGKWISAV
LPGFFPVLLAAFILSVIGIRIILLAVPRKKENSARADVSSRKKGRFAGLLQNPETADADG
SGEIGILESMVLGVAVSANALTNGLSAGLIGLSPAAISITAAFGSFLTIWLGCLLGKKAS
SLRIGSFHVGQFSTVLSGVIILIIAVNTLLF
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcttggttattgattttaggtttggcagtgtcctcgagcattgataatttaggagtg
gggatgtcatacggcatcagaaagatcaaaatatcgcacgcgtcaaatatgatgatcgct
tttatctgttttttattcagttatatcgggatttatttcggcaaatggatttcagccgtt
ctgcctggtttttttcccgtcttgctggcggcttttatcttatctgtcatcggcatccgc
atcatcctgctggctgtgccgagaaaaaaagaaaattcagcgcgtgctgatgtgtcatca
agaaaaaaaggccgttttgccggtctgttacaaaacccggagacagcagatgctgacggt
tcgggagaaatcggtatattggaatccatggtcctcggagtggccgtatccgcaaatgcg
ctgactaacggattaagcgcaggtctgatcgggctttctcccgccgcaatttccatcact
gcggcgttcggaagttttctgaccatatggctcggctgcttgcttggaaaaaaagcttcg
tcattgcgcatcggatctttccatgtcggacagttcagcacggtgctgagcggagtgatt
attctcatcattgccgtcaatacgctgctcttttaa

DBGET integrated database retrieval system