KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2320Help
Entry
BAMF_2320         CDS       T01321                                 

Gene name
RBAM_022500
Definition
(GenBank) RBAM_022500
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 DUF1232 HTH_26 HTH_31 HTH_37 BetR
Motif
Other DBs
NCBI-ProteinID: CBI43446
Position
2381803..2382435
Genome map
AA seq 210 aa AA seqDB search
MAENENNTLGPLLKSLLDKHSLSMRKLGALTNIDTATISRIINGKQKANLKHLQEFSKHL
RTPLEELLEASGIDIGHDKEAAPQDPMHAIQDMLNMAEMFDQPFSREQIERELTRYEQYA
KTQQGHRLICDEFQKKMDNEESVGPFIDHLKNMHHQYMDESTPAEDRAILGSALLYYILA
TDVIPDYMFPIGYLDDAIAVQIALHRLKKK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
ttggcagaaaatgaaaataatacattgggcccccttttaaaatcactgcttgataagcac
tcgctctccatgagaaaactcggcgccttaaccaacattgatacggccaccatctcccgg
attataaacggcaagcagaaggccaatttaaagcatcttcaggaattttcaaaacacctc
cgcaccccgctggaggaattgcttgaggcgtcaggcatagacatcggccatgataaagaa
gctgcgccgcaagatccgatgcacgcgattcaggatatgctgaatatggcggagatgttt
gatcagcctttttcccgggagcaaattgaacgcgagctgaccagatatgaacaatatgcc
aaaacccagcagggccatcgcctgatttgtgatgagtttcaaaagaaaatggataacgaa
gaaagcgtcggcccttttattgatcacttgaaaaacatgcatcatcaatatatggatgaa
tcaacaccggctgaagaccgcgcgattctcgggagcgcgctgctgtattatattttggcg
acggacgtcattccggattacatgtttccgatcggctatctggacgacgcgatcgccgtt
caaatcgctttgcatcggctgaaaaaaaagtaa

DBGET integrated database retrieval system