KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2338Help
Entry
BAMF_2338         CDS       T01321                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase subunit (biotin carboxylase subunit)
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00061  Fatty acid biosynthesis
bao00620  Pyruvate metabolism
bao00640  Propanoate metabolism
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
bao01212  Fatty acid metabolism
Module
bao_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAMF_2338 (accC)
   00640 Propanoate metabolism
    BAMF_2338 (accC)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BAMF_2338 (accC)
Enzymes [BR:bao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BAMF_2338 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BAMF_2338 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 GARS_A ATP-grasp_5 Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: CBI43464
Position
complement(2398579..2399931)
Genome map
AA seq 450 aa AA seqDB search
MIKKLLIANRGEIAVRIIRACKELGIETVAVYSEADKDALHVQMADEAFCIGPKTSKESY
LNVTNIVSVAKLTGTDAIHPGYGFLAENADFAELCEEVNVTFVGPTADAISKMGTKDIAR
ETMQLAGVPIVPGSKGIIKNTEEAVSLAREIGYPVIIKATAGGGGKGIRVARTEEEMIKG
IEITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADNYGNTIHLGERDCSIQRRLQKLLE
ESPSPALDSEIREQMGEAAVKAAKAVGYTGAGTVEFIYDYREQRYYFMEMNTRIQVEHPV
TEMVTGTDLIKEQIKVASGQELSLRQEDVEFNGWAIECRINAENPAKNFMPSPGKINMYL
PPGGLGVRVDSAAYPGYSIPPYYDSMIAKVITYGTTRDEAVARMKRALSEFVIEGIETTI
PFHLKLLEHETFVSGEFNTKFLETYDVMGS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaagctattgatcgccaaccgaggagaaattgccgtcagaatcatccgggcc
tgcaaggagcttggcattgaaactgtagccgtttattctgaggcagataaagacgccctg
catgtccaaatggccgatgaggctttttgtatcgggccgaaaacatcaaaagaaagctat
ttaaacgtaacgaatatcgtcagcgtcgcaaagctgaccggcacggatgcgattcatccg
ggatacggatttttagctgaaaacgccgactttgccgagctgtgcgaggaagtaaacgtg
acgtttgtcggccctacggcagacgccatttcaaaaatggggacaaaagatatcgcccgt
gagacgatgcaactggcgggcgtgccgattgtgcccggttcaaaaggaattataaaaaat
acggaagaagcggtttcacttgcacgtgaaattgggtatcctgtcattataaaagccact
gcgggcggaggcggaaaaggcatccgggtcgcgcgcacagaagaagaaatgattaaaggc
attgaaatcacccagcaggaagccgctacggcattcggaaatccgggtgtgtacatcgag
aagtacatagaagatttccgccatgttgaaattcaggtgcttgcggataattacggaaac
acgatccatcttggagagcgtgactgttctatccaaagacgtctgcaaaaacttcttgaa
gagtcgccgtcacctgcgcttgattctgaaatcagggagcagatgggcgaagcagcggta
aaagcagcgaaggccgtcggttacacgggagcgggcactgtagagttcatttatgactac
agagagcagcgctactacttcatggagatgaacacgcgtattcaagtggagcaccctgtc
actgaaatggtgacgggaaccgatctgatcaaagaacagatcaaagtggcatccggacag
gagctctcgctcagacaggaagacgtagaatttaacggctgggcgattgaatgccgtatc
aacgctgaaaatcctgcgaaaaacttcatgccttcacctggtaaaattaacatgtacctg
ccgccgggcggactcggcgtgcgtgtggattcagccgcatatccgggctattcgatcccg
ccgtactatgacagtatgattgccaaagtcatcacatacggaacaacacgtgatgaggcg
gtcgcacggatgaaacgcgcgctgagcgaattcgtgatcgaaggtattgaaacaacgatt
ccgttccatctgaaactgcttgaacacgaaacatttgtcagcggagagtttaatacaaag
tttttagaaacatatgatgtaatgggctcataa

DBGET integrated database retrieval system