KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2344Help
Entry
BAMF_2344         CDS       T01321                                 

Gene name
spoIIIAD
Definition
(GenBank) stage III sporulation protein
  KO
K06393  stage III sporulation protein AD
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIIAC
Motif
Other DBs
NCBI-ProteinID: CBI43470
Position
complement(2403804..2404106)
Genome map
AA seq 100 aa AA seqDB search
MIVVFSGCVIFLYLVDQIYDIIRMIEKIAVNANVNMVYVETILKIIGIAYIAEFGAQLTK
DAGQGAIASKIELAGKILILVMAVPILTVIIETILGLIPS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcgtcttcagcggctgcgtgatctttctttatctcgttgaccagatttatgac
attatcagaatgatagaaaaaatagccgtcaatgcaaacgtcaatatggtctatgtggaa
accattttaaaaattatcggcattgcctacatcgctgaattcggagcgcagcttacaaaa
gatgcgggccagggagcgattgcttcgaaaatagagctggccgggaagattttgattctg
gtgatggctgtgccgatactgactgttattattgaaacgattctcggacttattccttct
tga

DBGET integrated database retrieval system